DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13604 and YLR345W

DIOPT Version :9

Sequence 1:NP_001262894.1 Gene:CG13604 / 42840 FlyBaseID:FBgn0039137 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_013449.1 Gene:YLR345W / 851059 SGDID:S000004337 Length:509 Species:Saccharomyces cerevisiae


Alignment Length:430 Identity:88/430 - (20%)
Similarity:155/430 - (36%) Gaps:135/430 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 PDIIEGSSFEESEQSVEKYLRQTLKPCL--------ELPSVQLLNSHNLTHQHNPNTPTIEITTN 439
            |...||.:|      |||...|.|...|        :|.....||...:..: |..|...||...
Yeast   138 PTSKEGVAF------VEKLRMQMLNDILAFFNDLSGQLAIYDALNIRKIDRK-NLETTFSEIGVK 195

  Fly   440 MSSSSTSMSKQPVDEILVEPPAAQPPRPDDTLSVHSDHSLHPGSLDASHAKNRKIY-IMRHGERV 503
            :....:.:|    |:.::....|.....:|...:.:|.::.......|  .|...| :|.|.|.:
Yeast   196 VLFIESIVS----DQEIMNRNIALALESNDYKGLSTDEAIDEYMRRLS--VNEPYYEMMTHDEEL 254

  Fly   504 DF----TFGTWIPYCFDEFGNYMRKDLNMPKTLPRRK----------NSPEGWQNDSPLTNVGVY 554
            .:    ..|..|....:..|..:.|.:.....|.::|          :..:.:.:|..|...|::
Yeast   255 SYIKYINLGKQIIVKDNIHGYLVNKIVFFLMNLRQKKGCVYFARCGTSDKDNYIHDEELNEEGIH 319

  Fly   555 QANLIGQALLEAQVQ--------------ID--H---------VYCSPSYRCIQTCTSAL----E 590
            .:.::...:|:...|              ||  |         |:..|..|   |..:||    |
Yeast   320 YSQVLKDFVLQRIKQKRQAKKNSDSLVEVIDGSHDEDLKTSLIVWTGPRKR---THDTALFFSKE 381

  Fly   591 GLKLTGKQKIK-LEPGLFEWMAWYPSGVPDWLTKNELTEAKFDVDLDYEPVQPASELTARLKEST 654
            |:|:..:.::: |.||          .:.| ||..::.: ||               .:..|||.
Yeast   382 GIKVQQRSELRQLNPG----------SIAD-LTDQQIMD-KF---------------PSEYKESL 419

  Fly   655 EQFY-------ERNHDVILQL------LEQTTGNILVVAHATTLDTCSRQLTGGVPRST------ 700
            :..|       |..||:.:::      :|.|:.:||::||.:||    |.|.|.:...|      
Yeast   420 KDPYHFRFPRAESYHDLAVRMEPLLLEMEHTSKDILIIAHESTL----RVLYGYLMACTCVELPN 480

  Fly   701 -NELRQVIHKI---PYCSLATVEQVDGVWKLVEPECLPVT 736
             |..|..:.:|   |:|:  |||.::          :|:|
Yeast   481 LNFTRDKLVEISFSPFCN--TVELLN----------IPLT 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13604NP_001262894.1 UBA_UBS3B 23..60 CDD:270486
SH3_UBASH3 275..333 CDD:212725
His_Phos_1 494..728 CDD:278716 62/301 (21%)
YLR345WNP_013449.1 6PF2K 71..291 CDD:396253 33/165 (20%)
PhoE 290..505 CDD:223483 53/260 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.