DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13604 and AT3G60440

DIOPT Version :9

Sequence 1:NP_001262894.1 Gene:CG13604 / 42840 FlyBaseID:FBgn0039137 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_191603.2 Gene:AT3G60440 / 825215 AraportID:AT3G60440 Length:291 Species:Arabidopsis thaliana


Alignment Length:305 Identity:70/305 - (22%)
Similarity:118/305 - (38%) Gaps:77/305 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 SLDASHAKN----RKIYIMRHGERVDFTFGTWIPYCFDEFGNYMRKDLNMPKTLPRRKNSPEGWQ 543
            :::::.:||    :.|.:||||:|:|.....|:                        ..:...| 
plant    23 TMESAKSKNPDSYQNILMMRHGDRIDKIDPLWL------------------------DTAARPW- 62

  Fly   544 NDSPLTNVGVYQANLIGQALLEAQVQ--IDHVYCSPSYRCIQTCTSALEGLKLTG---------- 596
             |.||...|:.:|...||. :.:|:|  |..|:.||..|||||.:..:..|....          
plant    63 -DPPLVQDGMVRAFQTGQR-IRSQIQFPIHRVFVSPFIRCIQTASEVIAALSAVDFDPNATSSKD 125

  Fly   597 -------KQKIKLEPGLFEWM---AWYPSGVP-----DWLTKNELTEAKFDVDLDYEPVQPASEL 646
                   |.|:.:|.||.|.:   |..|...|     |::. :|| ||.|...:....|.|..:.
plant   126 VTSIDKYKLKVSIEFGLSEMLNSIAIKPEIAPKDGKFDFMI-SEL-EAIFPDGMVDHSVDPVYKE 188

  Fly   647 TARLKESTEQFYERNHDVILQLLEQ-TTGNILVVAHATTLDTCSRQLTGGVPRSTNELRQVIHKI 710
            ..:.:|:.|...:|...:|..|.:: .:.|:|:|.|...:.|......|          ..::.:
plant   189 MPQWEETVEGCTDRFLSLIKTLADKYPSENLLLVTHGEGVRTTFATFKG----------VHVYDV 243

  Fly   711 PYCSLA----TVEQVDGVWKLVEPECLPVTHSKNPRFEWNALSAT 751
            .||..|    .|...||..|..:.|.  :|.......::::||.|
plant   244 EYCGCAELRRQVSSKDGSTKAGDFEV--ITSLSQCGIKYHSLSTT 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13604NP_001262894.1 UBA_UBS3B 23..60 CDD:270486
SH3_UBASH3 275..333 CDD:212725
His_Phos_1 494..728 CDD:278716 63/265 (24%)
AT3G60440NP_191603.2 PhoE 37..239 CDD:223483 56/240 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102745
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1080
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.