DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13604 and Pfkfb4

DIOPT Version :9

Sequence 1:NP_001262894.1 Gene:CG13604 / 42840 FlyBaseID:FBgn0039137 Length:763 Species:Drosophila melanogaster
Sequence 2:XP_038937937.1 Gene:Pfkfb4 / 54283 RGDID:3310 Length:506 Species:Rattus norvegicus


Alignment Length:382 Identity:79/382 - (20%)
Similarity:125/382 - (32%) Gaps:147/382 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 PDIIEGSSFEESEQSVEKYLRQTLKPCLELPSVQLLNSH-NLTHQHNPNTPTIEITTNMSSSSTS 446
            ||.:.    .:|:::.|.::|:.  .|.|       ||: :|..:.:...|..|:        .:
  Rat   177 PDYVN----RDSDEATEDFMRRI--ECYE-------NSYESLDEEQDRWIPWAEL--------RA 220

  Fly   447 MSKQPVDEILVEPPAAQPP-RPDDTLSVHSDHSL-----------------HPGS-----LDASH 488
            :...||...::  |.|.|| :...|.|:..|.|.                 |..|     |...|
  Rat   221 LQLVPVAAAVL--PRAWPPSQALSTFSLARDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLMNIH 283

  Fly   489 AKNRKIYIMRHGERVDFTFGTWIPYCFDEFGNYMRKDLNMPKTLPRRKNSPEGWQNDSPLTNVGV 553
            ...|.||:.||||                      .:||:...:          ..|..|:..|.
  Rat   284 VTPRSIYLCRHGE----------------------SELNLKGRI----------GGDPGLSPRGR 316

  Fly   554 YQANLIGQALLEAQVQIDHVYCSPSYRCIQTCTSALEGLKLTGKQKIKLEPGLFEWMAWYPSGVP 618
            ..:..:.|.:.:..::...|:.|...|.|||.    |.|.:..:|                    
  Rat   317 EFSKHLAQFISDQNIKDLKVWTSQMKRTIQTA----EALSVPYEQ-------------------- 357

  Fly   619 DWLTKNELTEAKFDVDLDYEPVQPASELTARLK------------ESTEQFYERNHDVILQLLEQ 671
             |...||: :|....::.||.:|....|...|:            ||.|...:|...||::|..|
  Rat   358 -WKVLNEI-DAGVCEEMTYEEIQDHYPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQ 420

  Fly   672 TTGNILVVAH--------ATTLDTCSRQLTGGVPRSTNELRQVIHKIPY--CSLATV 718
            .  |:||:.|        |..||..:.:|                  ||  |.|.||
  Rat   421 E--NVLVICHQAVMRCLLAYFLDKAAEEL------------------PYLKCPLHTV 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13604NP_001262894.1 UBA_UBS3B 23..60 CDD:270486
SH3_UBASH3 275..333 CDD:212725
His_Phos_1 494..728 CDD:278716 52/247 (21%)
Pfkfb4XP_038937937.1 6PF2K 30..286 CDD:396253 26/131 (20%)
His_Phos_1 289..475 CDD:395236 52/247 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.