DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13604 and F55A11.11

DIOPT Version :9

Sequence 1:NP_001262894.1 Gene:CG13604 / 42840 FlyBaseID:FBgn0039137 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_001370163.1 Gene:F55A11.11 / 3565838 WormBaseID:WBGene00010082 Length:314 Species:Caenorhabditis elegans


Alignment Length:224 Identity:68/224 - (30%)
Similarity:103/224 - (45%) Gaps:45/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 KNRKI-----YIMRHGERVDFTFGT-WIPYCFDEFGNYMRK----DLNMPKTLPRRKNSPEGWQN 544
            |:.||     .:||..||||..||: |:     :...||.|    |:|:||.....   |..:..
 Worm    32 KSAKILKKVTVVMRSAERVDRVFGSAWL-----KSEKYMTKVNATDINVPKGAVLH---PHFYHF 88

  Fly   545 DSPLTNVGVYQANLIGQALLEAQVQIDHVYCSPSYRCIQTCTSALEGLKLTGKQKIKLEPGLFEW 609
            :.|:||:|.|.|.|||:||....::...::|||:.|.:||..:.   .|.|| .:|.:||||.|.
 Worm    89 NPPITNIGKYSAQLIGRALRNRGIEPGVIFCSPTLRTLQTAAAI---AKSTG-ARILVEPGLLEP 149

  Fly   610 MAWY----PSGVPDWLTKNELTEAKFDVDLDYEPVQPASELTARLKESTEQFYERNHDVILQLLE 670
            |.||    ...:||:          ||..||:..|....:....:.|.|..|..::.:..:|.:.
 Worm   150 MEWYRRAGAKQLPDF----------FDEALDFPQVDKTYKPIFSMHEFTSMFGAKSQEQCIQRIM 204

  Fly   671 QTTGNI---------LVVAHATTLDTCSR 690
            ....||         |::.||.|:|..|:
 Worm   205 LVVKNICVIFRDTPALIIGHAVTMDVASK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13604NP_001262894.1 UBA_UBS3B 23..60 CDD:270486
SH3_UBASH3 275..333 CDD:212725
His_Phos_1 494..728 CDD:278716 66/220 (30%)
F55A11.11NP_001370163.1 HP 87..>231 CDD:416258 47/157 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130139at33208
OrthoFinder 1 1.000 - - FOG0002396
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16469
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1080
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.