DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13604 and AT3G60415

DIOPT Version :9

Sequence 1:NP_001262894.1 Gene:CG13604 / 42840 FlyBaseID:FBgn0039137 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_191601.1 Gene:AT3G60415 / 28719419 AraportID:AT3G60415 Length:270 Species:Arabidopsis thaliana


Alignment Length:258 Identity:58/258 - (22%)
Similarity:92/258 - (35%) Gaps:86/258 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 NRKIYIMRHGERVDFTFGTWIPYCFDEFGNYMRKDLNMPKTLPRRKNSPEGWQNDSPLTNVGVYQ 555
            ::.:.:||||:|:|.....|                        ...:...|  |.||...|..:
plant    11 HQNVILMRHGDRLDNFEPLW------------------------TSTAARPW--DPPLAQDGKDR 49

  Fly   556 ANLIGQAL-LEAQVQIDHVYCSPSYRCIQTCTSALEGLKLTG-----------------KQKIKL 602
            |...||.: .:..|.|..|:.||..|||||.:..:..|....                 |.|:.:
plant    50 AFRTGQRIRSQLGVPIHRVFVSPFLRCIQTASEVVAALSAVDFDPIAMSSKDVLSIDNTKIKVAI 114

  Fly   603 EPGLFEWMAWYPSGVPDWLTKNELT--EAKFDVDL-DYEPVQPASELTARLK----------EST 654
            |.||.|    .|..:   ..|:|:.  :.|||..: |.|.:.|...:.:.:.          ||.
plant   115 EFGLSE----IPHPI---FIKSEVAPKDGKFDFKISDLEAMFPEGTVDSNVDMVYKEVPEWGESA 172

  Fly   655 EQFYERNHDVILQLLEQ-TTGNILVVAH--------------AT--TLDTCS-----RQLTGG 695
            :.|.:|.:..:..|.|: .:.|:|:|.|              ||  .:|.|.     ||:..|
plant   173 QAFEDRYYKTVKILAEKYPSENLLLVTHWGAVSVAFYNYFKDATKYVVDYCGSVEMRRQILNG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13604NP_001262894.1 UBA_UBS3B 23..60 CDD:270486
SH3_UBASH3 275..333 CDD:212725
His_Phos_1 494..728 CDD:278716 58/255 (23%)
AT3G60415NP_191601.1 HP 14..214 CDD:386100 51/232 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1080
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.