DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Epp and Ubxn1

DIOPT Version :10

Sequence 1:NP_001262894.1 Gene:Epp / 42840 FlyBaseID:FBgn0039137 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_666205.1 Gene:Ubxn1 / 225896 MGIID:1289301 Length:297 Species:Mus musculus


Alignment Length:31 Identity:12/31 - (38%)
Similarity:14/31 - (45%) Gaps:13/31 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SAVFAILNLV-------------LRPFSLLL 108
            ||.|:.:|||             |.|.||||
Mouse   268 SAQFSHMNLVRQASGEAPDPHTGLYPQSLLL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EppNP_001262894.1 UBA_UBS3B 23..60 CDD:270486
SH3_UBASH3 275..333 CDD:212725
PhoE 492..728 CDD:440175
Ubxn1NP_666205.1 UBA_UBXN1 5..45 CDD:270487
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..214
Interaction with BRCA1. /evidence=ECO:0000250 43..297 9/28 (32%)
UBX_UBXN1 208..292 CDD:340470 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.