DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13604 and pfkb-1.2

DIOPT Version :9

Sequence 1:NP_001262894.1 Gene:CG13604 / 42840 FlyBaseID:FBgn0039137 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_500893.2 Gene:pfkb-1.2 / 177363 WormBaseID:WBGene00019295 Length:457 Species:Caenorhabditis elegans


Alignment Length:277 Identity:67/277 - (24%)
Similarity:94/277 - (33%) Gaps:84/277 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 HAKNRKIYIMRHGERVDFTFGTWIPYCFDEFGNYMRKDLNMPKTLPRRKNSPEGWQNDSPLTNVG 552
            |...|.||:.|||:              .|:                  |:......|||||..|
 Worm   242 HLLPRSIYLTRHGQ--------------SEY------------------NAMGRLGGDSPLTEDG 274

  Fly   553 VYQANLIGQALLEAQVQIDHVYCSPSYRCIQTCTSALEGLKLTGKQKIKLEPGLFEWMAW--YPS 615
            ...|:.:.....|.:|....|:||...|..||.            |.:|.:.....|.|.  ..:
 Worm   275 QKYASALADFFEEEEVPGLRVWCSQKVRAAQTA------------QHLKPDFHTEYWKALDELDA 327

  Fly   616 GVPDWLTKNELTEAKFDVDLDYEPVQPASELTARLK------ESTEQFYERNHDVILQLLEQTTG 674
            |:.:.||..::        |...|.|.....|.:..      ||.|....|...||::|..|  .
 Worm   328 GICEGLTYEDI--------LQRYPKQADDRATDKYHYRYPSGESYEDVVSRLEPVIMELERQ--A 382

  Fly   675 NILVVAHATTLDTCSRQLTGGVPRSTNELRQVIHKIPYCSL-----------ATVEQVD---GVW 725
            |:|||:|...| .|  .|.....|..:||..:  .||..||           :|:..:|   |.|
 Worm   383 NVLVVSHQAVL-RC--VLAYFYDRPLSELPYI--DIPLHSLVKLTPRAYHCDSTIYALDLESGEW 442

  Fly   726 KLVEPECLPVTHSKNPR 742
            .....: ||:..|  ||
 Worm   443 TETSDQ-LPLCDS--PR 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13604NP_001262894.1 UBA_UBS3B 23..60 CDD:270486
SH3_UBASH3 275..333 CDD:212725
His_Phos_1 494..728 CDD:278716 60/255 (24%)
pfkb-1.2NP_500893.2 6PF2K 23..245 CDD:279872 1/2 (50%)
His_Phos_1 248..428 CDD:278716 56/238 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.