DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13604 and F53B6.7

DIOPT Version :9

Sequence 1:NP_001262894.1 Gene:CG13604 / 42840 FlyBaseID:FBgn0039137 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_492409.2 Gene:F53B6.7 / 172710 WormBaseID:WBGene00009962 Length:316 Species:Caenorhabditis elegans


Alignment Length:316 Identity:70/316 - (22%)
Similarity:133/316 - (42%) Gaps:59/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 TTNMSSSSTSMSKQP--VDEILVEPPAAQPPRPDDTLSVHSDHSLHPGSLDASHAKNRKIYIMRH 499
            |:::.:|:.|..::|  .::.|.|             ..|.|   .||       :...|..|.|
 Worm    19 TSSIGASTYSSEEKPNAGEKFLTE-------------LAHID---QPG-------RELTIVAMSH 60

  Fly   500 GERVDFTFGTWIPYCFD----EFGNYMRKDLNM-PKTLPRRKNSPEGWQNDSPLTNVGVYQANLI 559
            .|.:...|..|:..|:.    |:..|   |:|| ||.:||   .|..::.|.|||..|...:...
 Worm    61 AESMGLIFPNWVRVCYRRGPMEYHPY---DMNMPPKLVPR---PPLHYKFDPPLTERGQIVSETY 119

  Fly   560 GQALLEAQVQIDHVYCSPSYRCIQTCTSALEGLKLTGKQKIKLEPGLFEWMAWYPSGVPDW-LTK 623
            |:.||.|.::...|:|||..:.:||....::||.|: ...|.::|.|..:....|:...:. |:.
 Worm   120 GRGLLNAGIRPFEVFCSPDMKSVQTAAFLIKGLGLS-YTTINIDPALLSYRQMLPTNFQEMLLSP 183

  Fly   624 NELTEAKFDVDLDYEPVQ------PASELTARLKESTEQFYERNHDVILQLLEQTTGNILVVAHA 682
            .......:.:::.|.|.|      ...:...|:    :.|:::|    :..:||.  .::|::..
 Worm   184 KAFFNMGYPINIQYLPSQGFIRAENIEDYNLRI----QAFFKKN----IAKIEQK--QVVVISDN 238

  Fly   683 TTLDTCSRQLTGGVPRSTNELRQVIHKIPYCSLATVEQVDGVWKLVEPECLPVTHS 738
            ..:|....:..    .:.:::.|.|.| |.|.:..:....|..::::...||:|.|
 Worm   239 VMVDLTRNEHV----ETVDDILQCIKK-PTCQMNFISLKKGEAQIMDSPILPLTKS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13604NP_001262894.1 UBA_UBS3B 23..60 CDD:270486
SH3_UBASH3 275..333 CDD:212725
His_Phos_1 494..728 CDD:278716 56/245 (23%)
F53B6.7NP_492409.2 PhoE 105..>236 CDD:223483 32/141 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002396
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16469
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.