DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13604 and Y18H1A.4

DIOPT Version :9

Sequence 1:NP_001262894.1 Gene:CG13604 / 42840 FlyBaseID:FBgn0039137 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_490770.1 Gene:Y18H1A.4 / 171661 WormBaseID:WBGene00021210 Length:220 Species:Caenorhabditis elegans


Alignment Length:236 Identity:64/236 - (27%)
Similarity:96/236 - (40%) Gaps:54/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 RKIYIMRHGERVDFTFGTWIPYCFDEFGNYMRKDLNMPKTLPRRKNSPEGWQNDSPLTNV-GVYQ 555
            |||:|:||.||.|.....|                       |:.:..:|..:|:.:.:| |..|
 Worm     7 RKIWIVRHAEREDNINRNW-----------------------RKLDGADGLTSDNSMLSVRGRQQ 48

  Fly   556 ANLIGQALLEAQVQIDHVYCSPSYRCIQTCTSALEGLKLTGKQKIKLEPGLFE--WMAWYPSGVP 618
            |.........|  ||.|.:.||..|.|:|.::.:|...:    |:|.:.||.|  ::...|.|. 
 Worm    49 AKECKNRFENA--QISHTFASPFDRTIETASTIIEDKGM----KVKADGGLCEALYLCDKPPGF- 106

  Fly   619 DWLTKNELTEAKFD-VDLDYEPVQPASELT-ARLKESTEQFYERNHDVILQLLEQTTGNILVVAH 681
             |.| ::|.| ||. |||||.||  .|:.| .|.....:....|....:..:.|:..||:|:|.|
 Worm   107 -WET-DKLAE-KFPLVDLDYIPV--FSKYTLPREGCGDDACVPRVGKTLRAIFEKYEGNLLLVGH 166

  Fly   682 ATTLDTCSRQLTGGVPRSTNELRQVIHKIPYCSLATVEQVD 722
            ..::..|...|.|              ...|...|||.:.:
 Worm   167 GASIGACHEVLMG--------------DFKYVGQATVSEFE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13604NP_001262894.1 UBA_UBS3B 23..60 CDD:270486
SH3_UBASH3 275..333 CDD:212725
His_Phos_1 494..728 CDD:278716 62/234 (26%)
Y18H1A.4NP_490770.1 His_Phos_1 9..179 CDD:278716 57/204 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102745
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.