DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5902 and AMMECR1

DIOPT Version :9

Sequence 1:NP_001163705.1 Gene:CG5902 / 42839 FlyBaseID:FBgn0039136 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_056180.1 Gene:AMMECR1 / 9949 HGNCID:467 Length:333 Species:Homo sapiens


Alignment Length:192 Identity:129/192 - (67%)
Similarity:153/192 - (79%) Gaps:0/192 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KTVAVPDMCLFCFEVLDCELNNVDGPSVPVFSNDAYPLFVTWKIGRDKRLRGCIGTFSAMELHHG 106
            |.|...:||.|||:||.|.|.....|..|.|:|:.|||||||||||||||||||||||||.||.|
Human   123 KMVVSAEMCCFCFDVLYCHLYGYQQPRTPRFTNEPYPLFVTWKIGRDKRLRGCIGTFSAMNLHSG 187

  Fly   107 LREYALTSAFKDSRFAPISRDELPRLTVSVSILQNFEEAQGHLDWQLGVHGIRIEFLTERGCKRT 171
            ||||.||||.|||||.|::|||||||..|||:|.|||:...:|||::|||||||||:.|:|.|||
Human   188 LREYTLTSALKDSRFPPMTRDELPRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRT 252

  Fly   172 ATYLPQVATEQGWDQLQTIDSLLRKGGYRAAITPETRKSIKLTRYRSQEIQMHYKEYREYQE 233
            |||||:||.|||||.:||||||||||||:|.||.|.||:||||||||:::.:.|.||..:::
Human   253 ATYLPEVAKEQGWDHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQ 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5902NP_001163705.1 AMMECR1 50..219 CDD:280112 122/168 (73%)
AMMECR1NP_056180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..120
AMMECR1 132..301 CDD:396443 122/168 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149646
Domainoid 1 1.000 255 1.000 Domainoid score I2051
eggNOG 1 0.900 - - E1_COG2078
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68944
Inparanoid 1 1.050 273 1.000 Inparanoid score I2996
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1274811at2759
OrthoFinder 1 1.000 - - FOG0002708
OrthoInspector 1 1.000 - - oto88739
orthoMCL 1 0.900 - - OOG6_101067
Panther 1 1.100 - - LDO PTHR13016
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1929
SonicParanoid 1 1.000 - - X1811
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.