DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5902 and YOR289W

DIOPT Version :9

Sequence 1:NP_001163705.1 Gene:CG5902 / 42839 FlyBaseID:FBgn0039136 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_014932.1 Gene:YOR289W / 854463 SGDID:S000005815 Length:251 Species:Saccharomyces cerevisiae


Alignment Length:189 Identity:66/189 - (34%)
Similarity:100/189 - (52%) Gaps:26/189 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PSVPVFSNDAYPLFVTWKIGRDKR-----------LRGCIGTFSAMELHHGLREYALTSAFKDSR 120
            |...:..|:...||:|||...:|.           ||||||||:.|.:.||:.:|:|.:|.:|.|
Yeast    57 PDFKIDYNEKTSLFITWKKKSNKHHTIDTNEENYILRGCIGTFAKMPIAHGIEKYSLIAALEDRR 121

  Fly   121 FAPISRDELPRLTVSVSILQNFE-------EAQGHL-DWQLGVHGIRIEFL-TERGCKRTATYLP 176
            |:||.:.||..|..|.:||.||:       ...|.: ||:||.|||.:.|. .:.|...:||:||
Yeast   122 FSPIQKRELVDLKCSCNILGNFKTIFRGGGNPNGDIFDWELGKHGIELYFKHPKTGTTCSATFLP 186

  Fly   177 QVATEQGWDQLQTIDSLLRKGGYRAAITP-----ETRKSIKLTRYRSQEIQMHYKEYRE 230
            .|..||.|::..|..:|:.|.||...|:.     || ..|::.||..::..:.|:|:.:
Yeast   187 DVMPEQHWNKEDTFANLIEKAGYWGNISEVMDNFET-YFIEVIRYEGKKSSITYEEFNK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5902NP_001163705.1 AMMECR1 50..219 CDD:280112 64/176 (36%)
YOR289WNP_014932.1 TIGR00296 12..251 CDD:273002 66/189 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344401
Domainoid 1 1.000 98 1.000 Domainoid score I1606
eggNOG 1 0.900 - - E1_COG2078
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I1439
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002708
OrthoInspector 1 1.000 - - oto99126
orthoMCL 1 0.900 - - OOG6_101067
Panther 1 1.100 - - LDO PTHR13016
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1929
SonicParanoid 1 1.000 - - X1811
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.