DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5902 and AT2G38710

DIOPT Version :9

Sequence 1:NP_001163705.1 Gene:CG5902 / 42839 FlyBaseID:FBgn0039136 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001031509.1 Gene:AT2G38710 / 818453 AraportID:AT2G38710 Length:214 Species:Arabidopsis thaliana


Alignment Length:188 Identity:92/188 - (48%)
Similarity:120/188 - (63%) Gaps:5/188 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DMCLFCFEVLDCELNNVDGPSVPVFSNDAYPLFVTWK---IGRDKRLRGCIGTFSAMELHHGLRE 109
            :|.::||:.|....||.:.|. |.|....:|||||||   .|.:.||||||||..|..|..|.::
plant     7 EMAVYCFDTLVSHYNNEETPP-PAFEEANHPLFVTWKKIVNGGEPRLRGCIGTLEARRLISGFKD 70

  Fly   110 YALTSAFKDSRFAPISRDELPRLTVSVSILQNFEEAQGHLDWQLGVHGIRIEFL-TERGCKRTAT 173
            ||||||.:|.||.||...|||.|..:||:|.::|:|:.:|||::|.|||.|||. .|...||:||
plant    71 YALTSALRDRRFPPIQAKELPSLQCTVSVLTDYEDAEDYLDWEVGKHGIIIEFTEPETNTKRSAT 135

  Fly   174 YLPQVATEQGWDQLQTIDSLLRKGGYRAAITPETRKSIKLTRYRSQEIQMHYKEYREY 231
            |||:|...:||.:::.||||:||.||...||...|:.|.||||:|....|||.||..|
plant   136 YLPEVPAHEGWTKIEAIDSLVRKAGYNGVITEAVRRRINLTRYQSTLFSMHYSEYLSY 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5902NP_001163705.1 AMMECR1 50..219 CDD:280112 84/172 (49%)
AT2G38710NP_001031509.1 AMMECR1 11..183 CDD:396443 85/172 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 166 1.000 Domainoid score I1204
eggNOG 1 0.900 - - E1_COG2078
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68944
Inparanoid 1 1.050 183 1.000 Inparanoid score I1434
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1274811at2759
OrthoFinder 1 1.000 - - FOG0002708
OrthoInspector 1 1.000 - - oto3902
orthoMCL 1 0.900 - - OOG6_101067
Panther 1 1.100 - - LDO PTHR13016
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1811
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.830

Return to query results.
Submit another query.