DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5902 and Ammecr1

DIOPT Version :9

Sequence 1:NP_001163705.1 Gene:CG5902 / 42839 FlyBaseID:FBgn0039136 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_062369.1 Gene:Ammecr1 / 56068 MGIID:1860206 Length:344 Species:Mus musculus


Alignment Length:203 Identity:132/203 - (65%)
Similarity:157/203 - (77%) Gaps:1/203 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PQRFSNGHG-MKTVAVPDMCLFCFEVLDCELNNVDGPSVPVFSNDAYPLFVTWKIGRDKRLRGCI 95
            |...|:..| .|.|...:||.|||:||.|.|.....|..|.|:|:.|||||||||||||||||||
Mouse   123 PSSSSSSPGSRKMVVSAEMCCFCFDVLYCHLYGYQQPRTPRFTNEPYPLFVTWKIGRDKRLRGCI 187

  Fly    96 GTFSAMELHHGLREYALTSAFKDSRFAPISRDELPRLTVSVSILQNFEEAQGHLDWQLGVHGIRI 160
            ||||||.||.|||||.||||.|||||.|::|||||||..|||:|.|||:...:|||::|||||||
Mouse   188 GTFSAMNLHSGLREYTLTSALKDSRFPPMTRDELPRLFCSVSLLTNFEDVCDYLDWEVGVHGIRI 252

  Fly   161 EFLTERGCKRTATYLPQVATEQGWDQLQTIDSLLRKGGYRAAITPETRKSIKLTRYRSQEIQMHY 225
            ||:.|:|.||||||||:||.|||||.:||||||||||||:|.||.|.||:||||||||:::.:.|
Mouse   253 EFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSY 317

  Fly   226 KEYREYQE 233
            .||..:::
Mouse   318 AEYLAHRQ 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5902NP_001163705.1 AMMECR1 50..219 CDD:280112 122/168 (73%)
Ammecr1NP_062369.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
AMMECR1 142..312 CDD:280112 123/169 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839710
Domainoid 1 1.000 255 1.000 Domainoid score I2029
eggNOG 1 0.900 - - E1_COG2078
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68944
Inparanoid 1 1.050 273 1.000 Inparanoid score I2964
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1274811at2759
OrthoFinder 1 1.000 - - FOG0002708
OrthoInspector 1 1.000 - - otm42614
orthoMCL 1 0.900 - - OOG6_101067
Panther 1 1.100 - - LDO PTHR13016
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1929
SonicParanoid 1 1.000 - - X1811
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.