DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5902 and polr2d

DIOPT Version :9

Sequence 1:NP_001163705.1 Gene:CG5902 / 42839 FlyBaseID:FBgn0039136 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001016248.1 Gene:polr2d / 549002 XenbaseID:XB-GENE-1004238 Length:142 Species:Xenopus tropicalis


Alignment Length:66 Identity:15/66 - (22%)
Similarity:29/66 - (43%) Gaps:13/66 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 RTATYLPQVATEQGWDQLQTIDS-LLRKGGYR------AAITPETRKSIKLT------RYRSQEI 221
            :|..|..:.:..:..:.:.::.| ||:|..:|      |.:.|||....|..      |:..:|:
 Frog    63 KTLNYTARFSRFKNRETIASVRSLLLQKKLHRFELACLANLCPETADEAKALIPSLEGRFEEEEL 127

  Fly   222 Q 222
            |
 Frog   128 Q 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5902NP_001163705.1 AMMECR1 50..219 CDD:280112 13/61 (21%)
polr2dNP_001016248.1 RPOL4c 24..141 CDD:128904 15/66 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1274811at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.