powered by:
Protein Alignment CG5902 and polr2d
DIOPT Version :9
Sequence 1: | NP_001163705.1 |
Gene: | CG5902 / 42839 |
FlyBaseID: | FBgn0039136 |
Length: | 243 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001016248.1 |
Gene: | polr2d / 549002 |
XenbaseID: | XB-GENE-1004238 |
Length: | 142 |
Species: | Xenopus tropicalis |
Alignment Length: | 66 |
Identity: | 15/66 - (22%) |
Similarity: | 29/66 - (43%) |
Gaps: | 13/66 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 170 RTATYLPQVATEQGWDQLQTIDS-LLRKGGYR------AAITPETRKSIKLT------RYRSQEI 221
:|..|..:.:..:..:.:.::.| ||:|..:| |.:.|||....|.. |:..:|:
Frog 63 KTLNYTARFSRFKNRETIASVRSLLLQKKLHRFELACLANLCPETADEAKALIPSLEGRFEEEEL 127
Fly 222 Q 222
|
Frog 128 Q 128
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1274811at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.