DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5902 and ammecr1

DIOPT Version :9

Sequence 1:NP_001163705.1 Gene:CG5902 / 42839 FlyBaseID:FBgn0039136 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_956875.1 Gene:ammecr1 / 393553 ZFINID:ZDB-GENE-040426-1533 Length:309 Species:Danio rerio


Alignment Length:199 Identity:133/199 - (66%)
Similarity:155/199 - (77%) Gaps:1/199 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SNGHG-MKTVAVPDMCLFCFEVLDCELNNVDGPSVPVFSNDAYPLFVTWKIGRDKRLRGCIGTFS 99
            |.|.| .|.|...:||.|||:||.|.|.....|..|.|:||.|||||||||||||||||||||||
Zfish    92 SPGSGARKMVVSAEMCCFCFDVLYCHLYGYQPPRTPRFTNDPYPLFVTWKIGRDKRLRGCIGTFS 156

  Fly   100 AMELHHGLREYALTSAFKDSRFAPISRDELPRLTVSVSILQNFEEAQGHLDWQLGVHGIRIEFLT 164
            ||.||.|||||.||||.|||||.|::|||||||..|||:|.|||:...:|||::|||||||||..
Zfish   157 AMNLHSGLREYTLTSALKDSRFPPMTRDELPRLFCSVSLLTNFEDVGDYLDWEVGVHGIRIEFFN 221

  Fly   165 ERGCKRTATYLPQVATEQGWDQLQTIDSLLRKGGYRAAITPETRKSIKLTRYRSQEIQMHYKEYR 229
            |:|.||||||||:||.|||||.:||||||||||||:|.||.:.||:||||||||:::.|.|.||.
Zfish   222 EKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGYKAPITNDFRKTIKLTRYRSEKMTMSYAEYI 286

  Fly   230 EYQE 233
            .:::
Zfish   287 AHRQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5902NP_001163705.1 AMMECR1 50..219 CDD:280112 122/168 (73%)
ammecr1NP_956875.1 AMMECR1 107..277 CDD:280112 123/169 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583795
Domainoid 1 1.000 255 1.000 Domainoid score I2014
eggNOG 1 0.900 - - E1_COG2078
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68944
Inparanoid 1 1.050 274 1.000 Inparanoid score I2947
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1274811at2759
OrthoFinder 1 1.000 - - FOG0002708
OrthoInspector 1 1.000 - - oto39679
orthoMCL 1 0.900 - - OOG6_101067
Panther 1 1.100 - - LDO PTHR13016
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1929
SonicParanoid 1 1.000 - - X1811
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.