DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5902 and Ammecr1l

DIOPT Version :9

Sequence 1:NP_001163705.1 Gene:CG5902 / 42839 FlyBaseID:FBgn0039136 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001100869.1 Gene:Ammecr1l / 307526 RGDID:1307915 Length:384 Species:Rattus norvegicus


Alignment Length:195 Identity:129/195 - (66%)
Similarity:153/195 - (78%) Gaps:3/195 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NGHGMKT---VAVPDMCLFCFEVLDCELNNVDGPSVPVFSNDAYPLFVTWKIGRDKRLRGCIGTF 98
            ||....|   |...:||.:||:||.|.|.....|.:|.|:||.||||||||.|||||||||||||
  Rat   167 NGTANTTKNLVVTAEMCCYCFDVLYCHLYGFPQPRLPRFTNDPYPLFVTWKTGRDKRLRGCIGTF 231

  Fly    99 SAMELHHGLREYALTSAFKDSRFAPISRDELPRLTVSVSILQNFEEAQGHLDWQLGVHGIRIEFL 163
            |||.||.|||||.||||.|||||.|::|:|||:|..|||:|.|||:|..:|||::|||||||||:
  Rat   232 SAMNLHSGLREYTLTSALKDSRFPPLTREELPKLFCSVSLLTNFEDASDYLDWEVGVHGIRIEFI 296

  Fly   164 TERGCKRTATYLPQVATEQGWDQLQTIDSLLRKGGYRAAITPETRKSIKLTRYRSQEIQMHYKEY 228
            .|:|.||||||||:||.||.|||:|||||||||||::|.||.|.|||||||||||:::.:.|.||
  Rat   297 NEKGIKRTATYLPEVAKEQDWDQIQTIDSLLRKGGFKAPITSEFRKSIKLTRYRSEKVTISYAEY 361

  Fly   229  228
              Rat   362  361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5902NP_001163705.1 AMMECR1 50..219 CDD:280112 120/168 (71%)
Ammecr1lNP_001100869.1 AMMECR1 183..353 CDD:280112 121/169 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343538
Domainoid 1 1.000 255 1.000 Domainoid score I1969
eggNOG 1 0.900 - - E1_COG2078
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 273 1.000 Inparanoid score I2910
OMA 1 1.010 - - QHG49403
OrthoDB 1 1.010 - - D1274811at2759
OrthoFinder 1 1.000 - - FOG0002708
OrthoInspector 1 1.000 - - otm44681
orthoMCL 1 0.900 - - OOG6_101067
Panther 1 1.100 - - O PTHR13016
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1811
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.