DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5902 and R166.3

DIOPT Version :9

Sequence 1:NP_001163705.1 Gene:CG5902 / 42839 FlyBaseID:FBgn0039136 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_496270.1 Gene:R166.3 / 174621 WormBaseID:WBGene00011303 Length:200 Species:Caenorhabditis elegans


Alignment Length:193 Identity:90/193 - (46%)
Similarity:124/193 - (64%) Gaps:4/193 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TVAVPDMCLFCFEVLDCELNNVDGPSVP-VFSNDAYPLFVTWKIGRDKRLRGCIGTFSAMELHHG 106
            |.|...|.::||:|::.:||....|.|| ...|...|||||||.|....|||||||||.:.|..|
 Worm     2 TSANIQMAVYCFDVINAQLNREKEPPVPKEIPNVKLPLFVTWKKGHQHDLRGCIGTFSDLRLGEG 66

  Fly   107 LREYALTSAFKDSRFAPISRDELPRLTVSVSILQNFEEAQGHLDWQLGVHGIRIEFLTERGCK-R 170
            |.|||.||||.||||.||||:|:|.|...||:|.|||......||.:|.||:|:.|  :.|.: |
 Worm    67 LNEYAKTSAFHDSRFKPISREEVPSLQCGVSLLINFEPIHNFRDWTIGRHGVRMNF--DDGHRNR 129

  Fly   171 TATYLPQVATEQGWDQLQTIDSLLRKGGYRAAITPETRKSIKLTRYRSQEIQMHYKEYREYQE 233
            :|.:||:||.||||:.::|||.|:||.||...|....|.::::.|::|.::.:.||:|..|::
 Worm   130 SAVFLPEVAQEQGWNHVETIDHLIRKSGYGGHINDALRSALRIVRFQSSKLVLDYKDYVNYKQ 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5902NP_001163705.1 AMMECR1 50..219 CDD:280112 82/170 (48%)
R166.3NP_496270.1 AMMECR1 11..179 CDD:280112 83/169 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161035
Domainoid 1 1.000 163 1.000 Domainoid score I2419
eggNOG 1 0.900 - - E1_COG2078
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68944
Inparanoid 1 1.050 178 1.000 Inparanoid score I2686
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49403
OrthoDB 1 1.010 - - D1274811at2759
OrthoFinder 1 1.000 - - FOG0002708
OrthoInspector 1 1.000 - - oto20497
orthoMCL 1 0.900 - - OOG6_101067
Panther 1 1.100 - - LDO PTHR13016
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1929
SonicParanoid 1 1.000 - - X1811
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.