DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5902 and ammecr1

DIOPT Version :9

Sequence 1:NP_001163705.1 Gene:CG5902 / 42839 FlyBaseID:FBgn0039136 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001116966.1 Gene:ammecr1 / 100144747 XenbaseID:XB-GENE-992102 Length:307 Species:Xenopus tropicalis


Alignment Length:192 Identity:130/192 - (67%)
Similarity:154/192 - (80%) Gaps:0/192 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KTVAVPDMCLFCFEVLDCELNNVDGPSVPVFSNDAYPLFVTWKIGRDKRLRGCIGTFSAMELHHG 106
            |.|...:||.|||:||.|.|.....|..|.|:||.|||||||||||||||||||||||||.||.|
 Frog    97 KMVVSAEMCCFCFDVLYCHLYGYQPPRTPRFTNDPYPLFVTWKIGRDKRLRGCIGTFSAMNLHSG 161

  Fly   107 LREYALTSAFKDSRFAPISRDELPRLTVSVSILQNFEEAQGHLDWQLGVHGIRIEFLTERGCKRT 171
            ||||.||||.|||||.|::|||||||..|||:|.|||:...:|||::|||||||||:.|:|.|||
 Frog   162 LREYTLTSALKDSRFPPMTRDELPRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRT 226

  Fly   172 ATYLPQVATEQGWDQLQTIDSLLRKGGYRAAITPETRKSIKLTRYRSQEIQMHYKEYREYQE 233
            |||||:||.|||||.:||||||||||||:|||:.:.||:||||||||:::.|.|.||..:::
 Frog   227 ATYLPEVAKEQGWDHIQTIDSLLRKGGYKAAISNDFRKTIKLTRYRSEKMTMSYAEYLSHRQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5902NP_001163705.1 AMMECR1 50..219 CDD:280112 122/168 (73%)
ammecr1NP_001116966.1 AMMECR1 105..275 CDD:376635 123/169 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 255 1.000 Domainoid score I2010
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68944
Inparanoid 1 1.050 275 1.000 Inparanoid score I2889
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1274811at2759
OrthoFinder 1 1.000 - - FOG0002708
OrthoInspector 1 1.000 - - otm47724
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1929
SonicParanoid 1 1.000 - - X1811
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.