DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31140 and AT3G26250

DIOPT Version :9

Sequence 1:NP_001262893.1 Gene:CG31140 / 42836 FlyBaseID:FBgn0051140 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_189256.1 Gene:AT3G26250 / 822227 AraportID:AT3G26250 Length:490 Species:Arabidopsis thaliana


Alignment Length:325 Identity:75/325 - (23%)
Similarity:116/325 - (35%) Gaps:108/325 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PTYCHHC----SDLLWGLIQQGYICEVCNFIIHERCVSSVVTPCSGIAPCIIK-NPVAHCWSEPT 75
            |..|..|    |:|::      |||..|:||:|:.|.|         .|.:|: :...||.|. |
plant    43 PQTCSLCAFKHSNLVF------YICPPCDFIVHQSCFS---------LPHVIRISRHLHCISF-T 91

  Fly    76 HHKRK---FCTVCRKRL-DETPAVHCLV--CEYFAHIEC---------------QDFAVPDCTEN 119
            |...|   .|.|||::: ::....||:.  |.|..|.:|               .:..|.:....
plant    92 HSFPKGDGICGVCRRKINNDYGGYHCIKNGCFYAVHSKCATQTNVWDGIGREGESEEEVEELEPF 156

  Fly   120 ATYVPGKELLNVKHQHHWREGNL---PSTSKCAYCKKTCWSSECL------TGYRCEWCGMTTHA 175
            .|...| .:.:..|:||    :|   .:|||.....|.|  ..|:      ..|.|..|....|.
plant   157 VTISDG-IIQHFSHEHH----HLTLDENTSKDYDENKLC--QACIMPIYFGNSYSCLQCDFILHE 214

  Fly   176 GCRMYLPTECNFGILQPIYLPPHSVSIPRTEVPIEAIIGVQVKSKTSLVRDYSCPS--------- 231
            .|     .:.:..:..||:  ||.:::. |:.|:.. :|..:.|...:..  :|||         
plant   215 EC-----AKLSRRLDHPIH--PHQLTLV-TDNPLRP-VGYSINSDRDICS--ACPSLCIAGFFYE 268

  Fly   232 -PDLSCPIPGAGSGSLTSLGLKELLELHRQ-------RLEQSKQH--FLLSTPPTPTSCGSISLC 286
             .:.:|.                 ..||.|       .|..|..|  ||.|.|....:|   |:|
plant   269 CSERNCD-----------------FRLHVQCARISEPLLHPSHMHPLFLTSKPDEERNC---SVC 313

  Fly   287  286
            plant   314  313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31140NP_001262893.1 C1 6..55 CDD:237996 14/42 (33%)
C1 69..116 CDD:197519 17/67 (25%)
C1_1 135..185 CDD:278556 14/58 (24%)
RA 833..922 CDD:279168
UBQ 923..1022 CDD:294102
RRM_SF 1032..1102 CDD:302621
DAGKc 1121..1266 CDD:214487
DAGK_acc 1302..1457 CDD:279003
AT3G26250NP_189256.1 C1_3 45..72 CDD:284959 11/32 (34%)
C1_2 101..131 CDD:281148 9/29 (31%)
C1_3 188..217 CDD:284959 8/35 (23%)
C1_2 369..400 CDD:281148
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275907at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.