DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31140 and DGK3

DIOPT Version :9

Sequence 1:NP_001262893.1 Gene:CG31140 / 42836 FlyBaseID:FBgn0051140 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_849980.1 Gene:DGK3 / 816388 AraportID:AT2G18730 Length:488 Species:Arabidopsis thaliana


Alignment Length:415 Identity:113/415 - (27%)
Similarity:171/415 - (41%) Gaps:84/415 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1103 LLLP-NIEPSMVPSDVRPLLVFVNVKSGGCQGLELISSFRKLLNPYQVFDLDNGGPLPGYVQPIT 1166
            |||| .....|.|.  .|::||:|..|||..|..|....::|::..|||||..            
plant    76 LLLPGGAVADMAPH--APMVVFINPNSGGRHGPVLKERLQQLMSEEQVFDLTE------------ 126

  Fly  1167 VFVIRPLIFDSIISLYVFRQI------------TNYKILVCGGDGTIGWVLQCLDNVGQDSECSS 1219
               ::|..|.. ..|....::            ...:|:|.|||||:||||.||..:.:|.:...
plant   127 ---VKPHEFVR-YGLGCLEKVAAEGDECAKECRARLRIMVAGGDGTVGWVLGCLGELNKDGKSQI 187

  Fly  1220 PPCAIVPLGTGNDLARVLCWGSGYTGGEDPL-------NLLRDVIEAEEIRLDRWTVVFHPEDKP 1277
            ||..::||||||||:|...|     ||..|.       ..|.........|||.|.::.   ..|
plant   188 PPVGVIPLGTGNDLSRSFGW-----GGSFPFAWRSAVKRTLHRASMGPVARLDSWKILV---SMP 244

  Fly  1278 EEPAMKAPSQTTGGAQNEDNSQI--------------FVMNNYFGIGIDADLCLDFHNAREENPN 1328
            ....:..|.......:||.:..:              .|..||..||:||.:...||:.|...|.
plant   245 SGEVVDPPYSLKPAEENELDQGLDAGIDAPPLAKAYEGVFYNYLSIGMDAQVAYGFHHLRNTKPY 309

  Fly  1329 QFNSRLRNKGYYVKMGLRK------IVGRKAVKDLQKELRLEVDGKI-------VELPP-VDGII 1379
            .....:.||..|...|..:      .|....::.|:..:::.:. |:       :.:|. |..|:
plant   310 LAQGPISNKIIYSSFGCSQGWFCTPCVNDPGLRGLRNIMKIHIK-KVNCSQWEEIAVPKNVRSIV 373

  Fly  1380 ILNILSWGSGANPWGPDKDDQ-----FSTPNHYDGMLEVVGVTGVVHLGQIQSGIRTAMRIAQGG 1439
            .||:.|:|||::|||..|.|.     |...:..||::|:.|.....|...:.:.:.:|..|||..
plant   374 ALNLHSYGSGSHPWGNLKPDYLEKRGFVEAHCDDGLIEIFGFKQGWHASFVMAELISAKHIAQAA 438

  Fly  1440 HIKIHLN----TDMPVQVDGEPWIQ 1460
            .::..|.    .|..:|:|||||.|
plant   439 AVRFELRGGDWRDAFLQMDGEPWKQ 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31140NP_001262893.1 C1 6..55 CDD:237996
C1 69..116 CDD:197519
C1_1 135..185 CDD:278556
RA 833..922 CDD:279168
UBQ 923..1022 CDD:294102
RRM_SF 1032..1102 CDD:302621
DAGKc 1121..1266 CDD:214487 49/163 (30%)
DAGK_acc 1302..1457 CDD:279003 47/177 (27%)
DGK3NP_849980.1 DAGK_cat 91..231 CDD:279163 48/160 (30%)
DAGK_acc 283..460 CDD:279003 47/177 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.