DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31140 and Dgkepsilon

DIOPT Version :9

Sequence 1:NP_001262893.1 Gene:CG31140 / 42836 FlyBaseID:FBgn0051140 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_001286362.1 Gene:Dgkepsilon / 36408 FlyBaseID:FBgn0020930 Length:534 Species:Drosophila melanogaster


Alignment Length:540 Identity:155/540 - (28%)
Similarity:234/540 - (43%) Gaps:134/540 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   973 QDYRCSEVLLDRGVTERILSWNERPWDIMKQLGKDSIRQMELMRFYMQHKQDPHGPNIALFVGNL 1037
            ::|||.:            .|               :|....:|....|             |||
  Fly    91 REYRCKD------------KW---------------LRNESSVRHLWVH-------------GNL 115

  Fly  1038 PTGLSQRNYEQILNKYVTDENKFISIGPIYYE---------YGSVVLTFEDSMKA---------V 1084
            |.|:...:..:.::.:|       |..|..|.         |.:...|..|||:|         :
  Fly   116 PMGVHCADCNEEVDHHV-------STDPGLYGWRCAWCQRCYHNDCYTRADSMEACDLGEFKDMI 173

  Fly  1085 RAFYNLRETIIEDKKLLVLLLPNIEPSMVPSDV---RPLLVFVNVKSGGCQGLELISSFRKLLNP 1146
            ...|:.......|...|.|      .|:.|.|:   .||:|..|.|||...|..::|..|..|:|
  Fly   174 FPPYSFVAARTRDSMRLHL------ASITPPDIENWEPLIVIANTKSGSSTGANVLSLLRGYLHP 232

  Fly  1147 YQVFDLDNGGPLPGYVQPITVFVIRPLIFDSIISLYVFRQITNYKILVCGGDGTIGWVLQCLDNV 1211
            .||.:|.:.||... :|.......||.                 :|||.||||||||||..:..:
  Fly   233 LQVMELGSRGPQDA-LQWAAKASPRPC-----------------RILVAGGDGTIGWVLNTIYTL 279

  Fly  1212 GQDSECSSPPCAIVPLGTGNDLARVLCWGSGYTGGEDPLNLLRDVIEAEEIRLDRWTVVFHPEDK 1276
            ....:   |..||:||||||||:|||.||:......||:.:||.:..|..:.|||:.:      :
  Fly   280 NIKPQ---PSVAIMPLGTGNDLSRVLGWGAEPPSVLDPVKILRSIRRARSVNLDRFDL------Q 335

  Fly  1277 PEE-----PAMKAPSQTTGGAQNEDNSQIFVMNNYFGIGIDADLCLDFHNAREENPNQFNSRLRN 1336
            .|:     |..:.|::|           |.|. |||.:|:||.:..:||..||......:||:.|
  Fly   336 IEKLHYRLPIQRHPTKT-----------IHVY-NYFSVGVDAYITYNFHKTRESRFYLLSSRIFN 388

  Fly  1337 KGYYVKMGLRKIVGRKAVKDLQKELRLEVDGKIVELPPVDGIIILNILSWGSGANPWGPDKDDQF 1401
            |..|...|.:::: :...:.::::|.|.:|.|.|:||.:..::.|||.|||:|.      |..:.
  Fly   389 KLLYFTFGTQQVM-QPGCEHIEEKLTLYLDNKPVQLPELQALVFLNIDSWGAGC------KLCEL 446

  Fly  1402 STPNH--------YDGMLEVVGVTGVVHLGQIQSGIRTAMRIAQGGHIKIHLNTDMPVQVDGEPW 1458
            |..|.        .|||:||.|:....|:.|:|..|...:||.|...|::.:...:|:|.|||||
  Fly   447 SNANGEVRIVNSISDGMMEVFGIVSSFHIAQLQCNISKPVRIGQAKQIRLQVKETVPMQADGEPW 511

  Fly  1459 IQSPGDVVVLKSALKATMLK 1478
            :|||.| :.|.|..:|.:||
  Fly   512 MQSPAD-IRLSSRSQARVLK 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31140NP_001262893.1 C1 6..55 CDD:237996
C1 69..116 CDD:197519
C1_1 135..185 CDD:278556
RA 833..922 CDD:279168
UBQ 923..1022 CDD:294102 6/48 (13%)
RRM_SF 1032..1102 CDD:302621 17/87 (20%)
DAGKc 1121..1266 CDD:214487 53/144 (37%)
DAGK_acc 1302..1457 CDD:279003 52/162 (32%)
DgkepsilonNP_001286362.1 C1_1 108..165 CDD:278556 16/76 (21%)
LCB5 207..519 CDD:224513 119/358 (33%)
DAGKc 207..331 CDD:214487 53/144 (37%)
DAGK_acc 355..510 CDD:279003 52/162 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462331
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1169
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275907at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11255
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.