DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31140 and dgkq

DIOPT Version :9

Sequence 1:NP_001262893.1 Gene:CG31140 / 42836 FlyBaseID:FBgn0051140 Length:1571 Species:Drosophila melanogaster
Sequence 2:XP_005174501.1 Gene:dgkq / 101882539 -ID:- Length:295 Species:Danio rerio


Alignment Length:306 Identity:71/306 - (23%)
Similarity:123/306 - (40%) Gaps:61/306 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   713 VLGRLLRQVRQGLSVGWRKPRYQKRRARSISEEFSSGDTPRFKDEESASKAESGHGPSSGGAGGG 777
            |.|||...:.|...|......:.|.....|||.....|.....|.::.|..              
Zfish    43 VFGRLRNMILQPGCVRICSRNFSKMHCYRISESSQHSDMDNLDDVDTQSPV-------------- 93

  Fly   778 GGSGGAGGSSAAGASASAAGGSSGHYRPDSGSGHKSDKSEKDREKKEKEREEKDIEMIKVFDGNN 842
                     :|..|.:|::        ||:|.                       :.:|||||::
Zfish    94 ---------TARDAQSSSS--------PDTGK-----------------------QTLKVFDGDD 118

  Fly   843 SFRRQQYRVIIVQRTYTLEQLLTTALRAFHITRDPQAFYLTDLYAPAGM--EDTPMLDPTPVLNL 905
            :.:|..:|::.:.|....|:::.:|||||:|..:.|.:.|.. |...|:  ||....:.||....
Zfish   119 AAKRNLFRLVSIPRIIKNEEVVESALRAFYIPDEAQDYELQS-YGQQGLFTEDIINRNGTPDNKS 182

  Fly   906 VHLEGKRPAIYLRFHDRDRGHVRVYPGKLQCSMLEDPYVSVPVDNSTVIKDLIRDALDKFGLQDN 970
            |..:....:..||...||...|::|||.|:..:   .|:||.....:.:..:|.:||.:.|.|:.
Zfish   183 VFKDAASDSWLLRAKPRDTEVVKIYPGLLKVGV---SYISVTAGRGSTVNSVITEALAQLGKQNE 244

  Fly   971 QIQDYRCSEVLL-DRGVTERILSWNERPWDIMKQLGKDSIRQMELM 1015
            ...|:...||.: .:.|..:|||..|...|.::::.|..:.:..|:
Zfish   245 NPDDFNLVEVFMSSKQVQRQILSGQELLLDKLQEIRKVCVSKAVLI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31140NP_001262893.1 C1 6..55 CDD:237996
C1 69..116 CDD:197519
C1_1 135..185 CDD:278556
RA 833..922 CDD:279168 26/90 (29%)
UBQ 923..1022 CDD:294102 25/94 (27%)
RRM_SF 1032..1102 CDD:302621
DAGKc 1121..1266 CDD:214487
DAGK_acc 1302..1457 CDD:279003
dgkqXP_005174501.1 C1 3..42 CDD:294036
UBQ 107..>158 CDD:294102 17/73 (23%)
UBQ 200..280 CDD:294102 23/82 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275907at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.