DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1sigma and APS2

DIOPT Version :9

Sequence 1:NP_001247273.1 Gene:AP-1sigma / 42835 FlyBaseID:FBgn0039132 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_012592.1 Gene:APS2 / 853521 SGDID:S000003819 Length:147 Species:Saccharomyces cerevisiae


Alignment Length:143 Identity:61/143 - (42%)
Similarity:94/143 - (65%) Gaps:6/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FMLLFSRQGKLRLQKWYMAY---PDKVKKKITRELVTTILARKPK-MCSFLEWKD-CKIVYKRYA 63
            |:|.|::||.:||.:|:..:   |.:.:..|. ::...|.:|..| ..:|:|:.| .|::|:|||
Yeast     5 FILCFNKQGVVRLVRWFDVHSSDPQRSQDAIA-QIYRLISSRDHKHQSNFVEFSDSTKLIYRRYA 68

  Fly    64 SLYFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQETSK 128
            .|||...::..|:|.:.|..||.:||:||.:||:||||||:|||.|.|.|:||:.|||||||.||
Yeast    69 GLYFVMGVDLLDDEPIYLCHIHLFVEVLDAFFGNVCELDIVFNFYKVYMIMDEMFIGGEIQEISK 133

  Fly   129 KNVLKAIASQDLL 141
            ..:|:.::..|.|
Yeast   134 DMLLERLSILDRL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1sigmaNP_001247273.1 AP1_sigma 4..145 CDD:341435 61/143 (43%)
APS2NP_012592.1 longin-like 3..146 CDD:365781 60/141 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X298
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.