DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1sigma and AT4G35410

DIOPT Version :9

Sequence 1:NP_001247273.1 Gene:AP-1sigma / 42835 FlyBaseID:FBgn0039132 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_195267.1 Gene:AT4G35410 / 829694 AraportID:AT4G35410 Length:162 Species:Arabidopsis thaliana


Alignment Length:143 Identity:93/143 - (65%)
Similarity:113/143 - (79%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLEWKDCKIVYKRYASL 65
            |:.|:||.|||||:||.|||..|..|.:.|:.|||...||.|.||:|:|:||:..|:||||||||
plant     1 MIHFVLLVSRQGKVRLTKWYSPYAQKERSKVIRELSGVILNRGPKLCNFVEWRGYKVVYKRYASL 65

  Fly    66 YFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQETSKKN 130
            |||..|:|.||||..|||||.|||:||:|||||||||:||||.|||:|||||||.||:||:|||.
plant    66 YFCMCIDQEDNELEVLEIIHHYVEILDRYFGSVCELDLIFNFHKAYYILDELLIAGELQESSKKT 130

  Fly   131 VLKAIASQDLLQE 143
            |.:.|::||.|.|
plant   131 VARIISAQDQLVE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1sigmaNP_001247273.1 AP1_sigma 4..145 CDD:341435 92/140 (66%)
AT4G35410NP_195267.1 APS2 1..150 CDD:227363 93/143 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 194 1.000 Domainoid score I917
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2908
Inparanoid 1 1.050 196 1.000 Inparanoid score I1337
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 1 1.000 - - otm3011
orthoMCL 1 0.900 - - OOG6_100926
Panther 1 1.100 - - LDO PTHR11753
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.