DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1sigma and ap1s2

DIOPT Version :9

Sequence 1:NP_001247273.1 Gene:AP-1sigma / 42835 FlyBaseID:FBgn0039132 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_012812612.1 Gene:ap1s2 / 733931 XenbaseID:XB-GENE-1006254 Length:166 Species:Xenopus tropicalis


Alignment Length:159 Identity:129/159 - (81%)
Similarity:136/159 - (85%) Gaps:4/159 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLEWKDCKIVYKRYASLY 66
            |.|||||||||||||||||:...||.|||||||||.|:|||||||||||||:|.|||||||||||
 Frog     7 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLY 71

  Fly    67 FCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQETSKKNV 131
            ||||||..||||:|||||||||||||||||||||||||||||||||||||.|:|||:||||||||
 Frog    72 FCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNV 136

  Fly   132 LKAIASQDLLQED----EAVEGTLRDIGL 156
            ||||...||||||    |.....|.:|||
 Frog   137 LKAIEQADLLQEDAKEAETPRSVLEEIGL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1sigmaNP_001247273.1 AP1_sigma 4..145 CDD:341435 123/144 (85%)
ap1s2XP_012812612.1 AP1_sigma 8..150 CDD:341435 122/141 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 247 1.000 Domainoid score I2107
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2908
Inparanoid 1 1.050 253 1.000 Inparanoid score I3116
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 1 1.000 - - otm48892
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.