DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1sigma and ap1s3a

DIOPT Version :9

Sequence 1:NP_001247273.1 Gene:AP-1sigma / 42835 FlyBaseID:FBgn0039132 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_009290225.1 Gene:ap1s3a / 550415 ZFINID:ZDB-GENE-050417-222 Length:163 Species:Danio rerio


Alignment Length:142 Identity:99/142 - (69%)
Similarity:120/142 - (84%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLEWKDCKIVYKRYASLY 66
            |.|:||||||||||||||:....|:.|:||.|:|...:|:|.||.|:||.|:|.||||:||||||
Zfish    11 MRFLLLFSRQGKLRLQKWFTVLSDRDKRKIIRDLTQMVLSRPPKACNFLPWRDLKIVYRRYASLY 75

  Fly    67 FCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQETSKKNV 131
            |||.:||:|||||||:|:||||||||:|||:|||||||||||||||||||.:||||:|||||.:|
Zfish    76 FCCGLEQDDNELLTLDILHRYVELLDQYFGNVCELDIIFNFEKAYFILDEFVIGGEVQETSKASV 140

  Fly   132 LKAIASQDLLQE 143
            .|:|...:.|||
Zfish   141 AKSIEEAESLQE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1sigmaNP_001247273.1 AP1_sigma 4..145 CDD:341435 98/140 (70%)
ap1s3aXP_009290225.1 Clat_adaptor_s 10..151 CDD:250451 96/139 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594698
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100926
Panther 1 1.100 - - O PTHR11753
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.