DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1sigma and ap1s1

DIOPT Version :9

Sequence 1:NP_001247273.1 Gene:AP-1sigma / 42835 FlyBaseID:FBgn0039132 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001314943.1 Gene:ap1s1 / 393279 ZFINID:ZDB-GENE-040426-1119 Length:158 Species:Danio rerio


Alignment Length:157 Identity:120/157 - (76%)
Similarity:137/157 - (87%) Gaps:1/157 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLEWKDCKIVYKRYASL 65
            ||.|||||||||||||||||.|..::.|||:.|||:..:|||||||||||||:|.||||||||||
Zfish     1 MMRFMLLFSRQGKLRLQKWYTATAERDKKKMVRELMQVVLARKPKMCSFLEWRDLKIVYKRYASL 65

  Fly    66 YFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQETSKKN 130
            |||||:|:.||||:|||:|||:|||||||||||||||||||||||||||||.|:|||||:||||:
Zfish    66 YFCCAVEEQDNELITLEVIHRFVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGEIQDTSKKS 130

  Fly   131 VLKAIASQDLLQ-EDEAVEGTLRDIGL 156
            |||||...|||| |||:....|.::||
Zfish   131 VLKAIEQADLLQEEDESPRSVLEEMGL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1sigmaNP_001247273.1 AP1_sigma 4..145 CDD:341435 113/141 (80%)
ap1s1NP_001314943.1 AP1_sigma 3..145 CDD:341435 112/141 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594697
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 1 1.000 - - otm24232
orthoMCL 1 0.900 - - OOG6_100926
Panther 1 1.100 - - O PTHR11753
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R60
SonicParanoid 1 1.000 - - X298
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.750

Return to query results.
Submit another query.