DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1sigma and ap4s1

DIOPT Version :9

Sequence 1:NP_001247273.1 Gene:AP-1sigma / 42835 FlyBaseID:FBgn0039132 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_005158818.1 Gene:ap4s1 / 368852 ZFINID:ZDB-GENE-030616-404 Length:144 Species:Danio rerio


Alignment Length:143 Identity:59/143 - (41%)
Similarity:97/143 - (67%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLEWKDCKIVYKRYASL 65
            |:.|:|:.::||:.||.|:|.|.....:..:..::|...|||:.:.|||:|:||.|:||::||:|
Zfish     1 MIKFLLMVNKQGQTRLSKYYEAVDLGKRAALEADVVRGCLARRKEECSFVEYKDYKLVYRQYAAL 65

  Fly    66 YFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQETSKKN 130
            :....:.:|:|||...|::|.:||:|||||..|.||||:||.:|.:.||||:::.|.|.||:|..
Zfish    66 FIVVGVTENENELSIYELVHNFVEVLDKYFSRVSELDIMFNLDKVHIILDEMILNGHIVETNKNR 130

  Fly   131 VLKAIASQDLLQE 143
            :|..:.:.|.:.|
Zfish   131 ILAPLLALDKMTE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1sigmaNP_001247273.1 AP1_sigma 4..145 CDD:341435 58/140 (41%)
ap4s1XP_005158818.1 APS2 1..143 CDD:227363 58/141 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.