DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1sigma and Ap1s3

DIOPT Version :9

Sequence 1:NP_001247273.1 Gene:AP-1sigma / 42835 FlyBaseID:FBgn0039132 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_038939904.1 Gene:Ap1s3 / 367304 RGDID:1311772 Length:178 Species:Rattus norvegicus


Alignment Length:140 Identity:106/140 - (75%)
Similarity:122/140 - (87%) Gaps:0/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLEWKDCKIVYKRYASLYFC 68
            |:|||||||||||||||...|||.:||||||::.|:|:|..:..||::||:.|:|||||||||||
  Rat    28 FILLFSRQGKLRLQKWYTTLPDKERKKITREIIQTVLSRGHRTSSFIDWKELKLVYKRYASLYFC 92

  Fly    69 CAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQETSKKNVLK 133
            ||||..|||||||||:||||||||||||:|||||||||||||||||||.:|||||||||||..:|
  Rat    93 CAIENQDNELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIGGEIQETSKKTAVK 157

  Fly   134 AIASQDLLQE 143
            ||...|:|||
  Rat   158 AIEDSDMLQE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1sigmaNP_001247273.1 AP1_sigma 4..145 CDD:341435 106/140 (76%)
Ap1s3XP_038939904.1 AP1_sigma 27..167 CDD:341435 104/138 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352752
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100926
Panther 1 1.100 - - O PTHR11753
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X298
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.