DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1sigma and vas2

DIOPT Version :9

Sequence 1:NP_001247273.1 Gene:AP-1sigma / 42835 FlyBaseID:FBgn0039132 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_593410.1 Gene:vas2 / 2542885 PomBaseID:SPAP27G11.06c Length:162 Species:Schizosaccharomyces pombe


Alignment Length:151 Identity:85/151 - (56%)
Similarity:119/151 - (78%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLEWKDCKIVYKRYASLYFC 68
            |.||.|||||:||.||:.....|.:.||.|::.:.::.||||||:|:|:|..||||:|||||:|.
pombe     5 FFLLVSRQGKVRLAKWFNTLSIKERAKIIRDVSSLVITRKPKMCNFVEYKGEKIVYRRYASLFFV 69

  Fly    69 CAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQETSKKNVLK 133
            |.|||:||||:.||:||::||.||||||:|||||:||||||||::::|||:.||:||:||.|||.
pombe    70 CGIEQDDNELIILEVIHKFVECLDKYFGNVCELDLIFNFEKAYYVMEELLLAGELQESSKTNVLS 134

  Fly   134 AIASQDLLQEDEAVEGTLRDI 154
            |:.:.|...|.:|.:.:|:.:
pombe   135 AVLAGDAESEADAQQDSLQKL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1sigmaNP_001247273.1 AP1_sigma 4..145 CDD:341435 83/140 (59%)
vas2NP_593410.1 APS2 2..153 CDD:227363 84/147 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 179 1.000 Domainoid score I818
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2908
Inparanoid 1 1.050 185 1.000 Inparanoid score I1075
OMA 1 1.010 - - QHG53551
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 1 1.000 - - oto101579
orthoMCL 1 0.900 - - OOG6_100926
Panther 1 1.100 - - LDO PTHR11753
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R60
SonicParanoid 1 1.000 - - X298
TreeFam 1 0.960 - -
1312.950

Return to query results.
Submit another query.