DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1sigma and aps2

DIOPT Version :9

Sequence 1:NP_001247273.1 Gene:AP-1sigma / 42835 FlyBaseID:FBgn0039132 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_596138.1 Gene:aps2 / 2541086 PomBaseID:SPBC685.04c Length:143 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:67/143 - (46%)
Similarity:101/143 - (70%) Gaps:1/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPK-MCSFLEWKDCKIVYKRYAS 64
            |:.|:|:.:|.||.||.|:|:.:.|..|.::...:...|..|..| ..:||||::.|:||:|||.
pombe     1 MIQFILIQNRHGKNRLSKYYVPFDDDEKVRLKARIHQLISQRNQKFQANFLEWENSKLVYRRYAG 65

  Fly    65 LYFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQETSKK 129
            ||||..::..||:|..||:||.:||:||.:||:|||||:||||.|...||||:::||||.|::||
pombe    66 LYFCFCVDSTDNDLAILEMIHFFVEILDSFFGNVCELDLIFNFYKVSAILDEIILGGEIGESNKK 130

  Fly   130 NVLKAIASQDLLQ 142
            :||:.|.:.:.|:
pombe   131 SVLERIEALEKLE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1sigmaNP_001247273.1 AP1_sigma 4..145 CDD:341435 66/140 (47%)
aps2NP_596138.1 APS2 1..143 CDD:227363 66/141 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X298
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.