DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1sigma and aps-1

DIOPT Version :9

Sequence 1:NP_001247273.1 Gene:AP-1sigma / 42835 FlyBaseID:FBgn0039132 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001379652.1 Gene:aps-1 / 178989 WormBaseID:WBGene00000159 Length:157 Species:Caenorhabditis elegans


Alignment Length:156 Identity:129/156 - (82%)
Similarity:141/156 - (90%) Gaps:0/156 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLEWKDCKIVYKRYASL 65
            ||.:||||||||||||||||.|||||.||||.|||:|.|||||||||:|||:||.|:||||||||
 Worm     1 MMQYMLLFSRQGKLRLQKWYTAYPDKQKKKICRELITQILARKPKMCAFLEYKDLKVVYKRYASL 65

  Fly    66 YFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQETSKKN 130
            |||||||||||||:|||:|||||||||||||||||||||||||||||||||.|:.|||||||||.
 Worm    66 YFCCAIEQNDNELITLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLAGEIQETSKKQ 130

  Fly   131 VLKAIASQDLLQEDEAVEGTLRDIGL 156
            ||||||:|||:||:|..:|...|.||
 Worm   131 VLKAIAAQDLIQEEETPQGFFEDHGL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1sigmaNP_001247273.1 AP1_sigma 4..145 CDD:341435 122/140 (87%)
aps-1NP_001379652.1 AP1_sigma 3..145 CDD:341435 122/141 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166283
Domainoid 1 1.000 252 1.000 Domainoid score I1144
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2908
Inparanoid 1 1.050 266 1.000 Inparanoid score I1869
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 1 1.000 - - oto17419
orthoMCL 1 0.900 - - OOG6_100926
Panther 1 1.100 - - LDO PTHR11753
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R60
SonicParanoid 1 1.000 - - X298
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.