DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1sigma and AP2S1

DIOPT Version :9

Sequence 1:NP_001247273.1 Gene:AP-1sigma / 42835 FlyBaseID:FBgn0039132 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_011524725.1 Gene:AP2S1 / 1175 HGNCID:565 Length:172 Species:Homo sapiens


Alignment Length:146 Identity:63/146 - (43%)
Similarity:94/146 - (64%) Gaps:14/146 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSF--------------LEWKD 54
            |:|:.:|.||.||.||||.:.|..|:|:..|:...:..|..|..:|              |::::
Human    20 FILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEVLAISVADSLSVLQFRN 84

  Fly    55 CKIVYKRYASLYFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLI 119
            .||:|:|||.||||..::.|||.|..||.||.:||:|::||.:|||||::|||.|.|.::||:.:
Human    85 FKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFL 149

  Fly   120 GGEIQETSKKNVLKAI 135
            .|||:|||:..|||.:
Human   150 AGEIRETSQTKVLKQL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1sigmaNP_001247273.1 AP1_sigma 4..145 CDD:341435 63/146 (43%)
AP2S1XP_011524725.1 Clat_adaptor_s 18..172 CDD:250451 63/146 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.