DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1sigma and AP4S1

DIOPT Version :9

Sequence 1:NP_001247273.1 Gene:AP-1sigma / 42835 FlyBaseID:FBgn0039132 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_009008.2 Gene:AP4S1 / 11154 HGNCID:575 Length:159 Species:Homo sapiens


Alignment Length:105 Identity:39/105 - (37%)
Similarity:67/105 - (63%) Gaps:0/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLEWKDCKIVYKRYASL 65
            |:.|.|:.::||:.||.|:|.......:..:..|::.:.|:|..:.|||:|:||.|::|::||:|
Human     1 MIKFFLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLSRSNEQCSFIEYKDFKLIYRQYAAL 65

  Fly    66 YFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIF 105
            :....:...:||:...|.||.:||:||:||..|.|||:.|
Human    66 FIVVGVNDTENEMAIYEFIHNFVEVLDEYFSRVSELDVSF 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1sigmaNP_001247273.1 AP1_sigma 4..145 CDD:341435 38/102 (37%)
AP4S1NP_009008.2 Clat_adaptor_s 1..>105 CDD:261170 38/103 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.