DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1sigma and Ap1s2

DIOPT Version :9

Sequence 1:NP_001247273.1 Gene:AP-1sigma / 42835 FlyBaseID:FBgn0039132 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001277308.1 Gene:Ap1s2 / 108012 MGIID:1889383 Length:160 Species:Mus musculus


Alignment Length:159 Identity:129/159 - (81%)
Similarity:136/159 - (85%) Gaps:4/159 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLEWKDCKIVYKRYASLY 66
            |.|||||||||||||||||:...||.|||||||||.|:|||||||||||||:|.|||||||||||
Mouse     1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLY 65

  Fly    67 FCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQETSKKNV 131
            ||||||..||||:|||||||||||||||||||||||||||||||||||||.|:|||:||||||||
Mouse    66 FCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNV 130

  Fly   132 LKAIASQDLLQED----EAVEGTLRDIGL 156
            ||||...||||||    |.....|.:|||
Mouse   131 LKAIEQADLLQEDAKEAETPRSVLEEIGL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1sigmaNP_001247273.1 AP1_sigma 4..145 CDD:341435 123/144 (85%)
Ap1s2NP_001277308.1 AP1_sigma 2..144 CDD:341435 122/141 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849138
Domainoid 1 1.000 247 1.000 Domainoid score I2154
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2908
Inparanoid 1 1.050 258 1.000 Inparanoid score I3126
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 1 1.000 - - otm43721
orthoMCL 1 0.900 - - OOG6_100926
Panther 1 1.100 - - LDO PTHR11753
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R60
SonicParanoid 1 1.000 - - X298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.