DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluProRS and Rpl39

DIOPT Version :10

Sequence 1:NP_524471.2 Gene:GluProRS / 42834 FlyBaseID:FBgn0005674 Length:1714 Species:Drosophila melanogaster
Sequence 2:NP_037007.1 Gene:Rpl39 / 25347 RGDID:3593 Length:51 Species:Rattus norvegicus


Alignment Length:30 Identity:8/30 - (26%)
Similarity:16/30 - (53%) Gaps:3/30 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   649 KQFIGHKTRDEVPMLGDPELKKCKKGDIIQ 678
            |:|:..|.:...|:   |:..:.|.|:.|:
  Rat    10 KRFLAKKQKQNRPI---PQWIRMKTGNKIR 36

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluProRSNP_524471.2 PLN02907 1..715 CDD:215492 8/30 (27%)
WEPRS_RNA 748..797 CDD:238473
WHEP-TRS 821..870 CDD:459819
WEPRS_RNA 894..943 CDD:238473
WEPRS_RNA 973..1022 CDD:238473
WEPRS_RNA 1048..1097 CDD:238473
WEPRS_RNA 1122..1169 CDD:238473
proS_fam_I 1219..1714 CDD:273062
Rpl39NP_037007.1 Ribosomal_L39 10..50 CDD:425894 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.