| Sequence 1: | NP_524471.2 | Gene: | GluProRS / 42834 | FlyBaseID: | FBgn0005674 | Length: | 1714 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_443201.1 | Gene: | RPL39L / 116832 | HGNCID: | 17094 | Length: | 51 | Species: | Homo sapiens |
| Alignment Length: | 30 | Identity: | 8/30 - (26%) |
|---|---|---|---|
| Similarity: | 15/30 - (50%) | Gaps: | 3/30 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 649 KQFIGHKTRDEVPMLGDPELKKCKKGDIIQ 678 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GluProRS | NP_524471.2 | PLN02907 | 1..715 | CDD:215492 | 8/30 (27%) |
| WEPRS_RNA | 748..797 | CDD:238473 | |||
| WHEP-TRS | 821..870 | CDD:459819 | |||
| WEPRS_RNA | 894..943 | CDD:238473 | |||
| WEPRS_RNA | 973..1022 | CDD:238473 | |||
| WEPRS_RNA | 1048..1097 | CDD:238473 | |||
| WEPRS_RNA | 1122..1169 | CDD:238473 | |||
| proS_fam_I | 1219..1714 | CDD:273062 | |||
| RPL39L | NP_443201.1 | Ribosomal_L39 | 10..50 | CDD:425894 | 8/30 (27%) |
| Blue background indicates that the domain is not in the aligned region. | |||||