DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12268 and LYS2

DIOPT Version :9

Sequence 1:NP_001247272.1 Gene:CG12268 / 42833 FlyBaseID:FBgn0039131 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_009673.1 Gene:LYS2 / 852412 SGDID:S000000319 Length:1392 Species:Saccharomyces cerevisiae


Alignment Length:294 Identity:69/294 - (23%)
Similarity:114/294 - (38%) Gaps:73/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ILITGATGFMGKVLVEKLL-RSCADLNV-IYLLIRTKKGVDPSVRKEQYFKCVIFGKLLEKNPGI 86
            :.:||.|||:|..::..|| ||..:.:. ::..:|.|.......|.::  ..:.:|...||   .
Yeast   973 VFVTGVTGFLGSYILADLLGRSPKNYSFKVFAHVRAKDEEAAFARLQK--AGITYGTWNEK---F 1032

  Fly    87 VDKVRVVKGDLLEPDLGLSANDTNTLASNVEVVFHCAANVRFDQPLRPMVMMNVVGTLKVLRLAE 151
            ...::||.|||.:...|||......||:.|:::.|..|.|.:..|...:...||:.|:.|:.|| 
Yeast  1033 ASNIKVVLGDLSKSQFGLSDEKWMDLANTVDIIIHNGALVHWVYPYAKLRDPNVISTINVMSLA- 1096

  Fly   152 KMSQLQALVHVSTSYCQCNESVLEERAYPAPQNP--FSIIEMVETMDDEALAEITPKLL------ 208
                                         |...|  |..:....|:|.|....::.||:      
Yeast  1097 -----------------------------AVGKPKFFDFVSSTSTLDTEYYFNLSDKLVSEGKPG 1132

  Fly   209 -----------NGLPNTYAYSKALSEDLICRYNNK-LPIIITRPSIVTAAIHEPLPGWIEGVNGP 261
                       :||...|..||..:|.:|.|...: |...|.||..||.|          ..||.
Yeast  1133 ILESDDLMNSASGLTGGYGQSKWAAEYIIRRAGERGLRGCIVRPGYVTGA----------SANGS 1187

  Fly   262 TG---LMIGAARGVIRSMHCNPDYASTV--IPVD 290
            :.   .::...:|.:: :...||..::|  :|||
Yeast  1188 SNTDDFLLRFLKGSVQ-LGKIPDIENSVNMVPVD 1220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12268NP_001247272.1 PLN02996 12..463 CDD:215538 69/294 (23%)
FAR-N_SDR_e 22..347 CDD:187547 69/294 (23%)
FAR_C 372..463 CDD:176924
LYS2NP_009673.1 alpha_am_amid 7..1379 CDD:274582 69/294 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I2873
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.712175 Normalized mean entropy S3219
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.