DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19b and RPS19B

DIOPT Version :9

Sequence 1:NP_001262891.1 Gene:RpS19b / 42830 FlyBaseID:FBgn0039129 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_014097.1 Gene:RPS19B / 855414 SGDID:S000005246 Length:144 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:61/136 - (44%)
Similarity:81/136 - (59%) Gaps:1/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPGVTVKEIDQHVLTKNMAAFLKKSGKIFVPEQAVYMKTGKFKETAPTD-DDWFYTRCASIMRHL 64
            |.||:|:::.........|:||::.||:.||.....:||....|..|.| :.|||.|.||:.||:
Yeast     1 MAGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDAEGWFYKRAASVARHI 65

  Fly    65 YLRSPAGVGAFTKVYSGRKRNGVRPSKHCRSSDGCIRKALQALEAANMVERHPDGGRKLTPQGQR 129
            |:|...|||...|:|.|.|..||||.||..:|....||.|||||...:||..|.|||:::..|||
Yeast    66 YMRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSINRKVLQALEKIGIVEISPKGGRRISENGQR 130

  Fly   130 NLDRIA 135
            :|||||
Yeast   131 DLDRIA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19bNP_001262891.1 Ribosomal_S19e 5..138 CDD:279436 58/132 (44%)
RPS19BNP_014097.1 Ribosomal_S19e 5..142 CDD:395866 58/132 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I1201
eggNOG 1 0.900 - - E1_COG2238
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I1227
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62169
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - mtm9212
orthoMCL 1 0.900 - - OOG6_100904
Panther 1 1.100 - - O PTHR11710
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X617
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.