DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19b and AT3G02080

DIOPT Version :9

Sequence 1:NP_001262891.1 Gene:RpS19b / 42830 FlyBaseID:FBgn0039129 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_186857.1 Gene:AT3G02080 / 821120 AraportID:AT3G02080 Length:143 Species:Arabidopsis thaliana


Alignment Length:139 Identity:69/139 - (49%)
Similarity:89/139 - (64%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GVTVKEIDQHVLTKNMAAFLKKSGKIFVPEQAVYMKTGKFKETAPTDDDWFYTRCASIMRHLYLR 67
            |.|||::..|...|..|:.||:||||.:|.....:||||.||.||.|.||:|.|.||:.|.:|||
plant     4 GKTVKDVSPHDFVKAYASHLKRSGKIELPTWTDIVKTGKLKELAPYDPDWYYIRAASMARKVYLR 68

  Fly    68 SPAGVGAFTKVYSGRKRNGVRPSKHCRSSDGCIRKALQALEAANMVERHPDGGRKLTPQGQRNLD 132
            ...|||||.::|.|.||||.||...|:||.|..|..||.||..|:||....|||::|..|||:||
plant    69 GGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGIARHILQQLETMNIVELDTKGGRRITSSGQRDLD 133

  Fly   133 RIANKIVAK 141
            ::|.:|..:
plant   134 QVAGRIAVE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19bNP_001262891.1 Ribosomal_S19e 5..138 CDD:279436 67/132 (51%)
AT3G02080NP_186857.1 Ribosomal_S19e 6..142 CDD:395866 68/135 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 154 1.000 Domainoid score I1350
eggNOG 1 0.900 - - E1_COG2238
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37416
Inparanoid 1 1.050 155 1.000 Inparanoid score I1675
OMA 1 1.010 - - QHG62169
OrthoDB 1 1.010 - - D1434984at2759
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - mtm1074
orthoMCL 1 0.900 - - OOG6_100904
Panther 1 1.100 - - O PTHR11710
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X617
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.