DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19b and rps19

DIOPT Version :9

Sequence 1:NP_001262891.1 Gene:RpS19b / 42830 FlyBaseID:FBgn0039129 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_957044.1 Gene:rps19 / 393723 ZFINID:ZDB-GENE-040426-1716 Length:146 Species:Danio rerio


Alignment Length:145 Identity:80/145 - (55%)
Similarity:101/145 - (69%) Gaps:1/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP-GVTVKEIDQHVLTKNMAAFLKKSGKIFVPEQAVYMKTGKFKETAPTDDDWFYTRCASIMRHL 64
            || |||||:::|....:.:|||||||||:.||:....:|..|.||.||.|::|||.|.||.:|||
Zfish     1 MPGGVTVKDVNQQEFVRALAAFLKKSGKLKVPDWVDIVKLAKHKELAPCDENWFYIRAASTVRHL 65

  Fly    65 YLRSPAGVGAFTKVYSGRKRNGVRPSKHCRSSDGCIRKALQALEAANMVERHPDGGRKLTPQGQR 129
            |||...|||:.||:|.|||||||.||.....|....||.|||||...|||:.|:|||:|||||.|
Zfish    66 YLRGGVGVGSMTKIYGGRKRNGVCPSHFSVGSKNVARKVLQALEGLKMVEKDPNGGRRLTPQGTR 130

  Fly   130 NLDRIANKIVAKQRE 144
            :|||||.::.|..::
Zfish   131 DLDRIAGQVAAASKK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19bNP_001262891.1 Ribosomal_S19e 5..138 CDD:279436 75/132 (57%)
rps19NP_957044.1 Ribosomal_S19e 6..139 CDD:279436 75/132 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583273
Domainoid 1 1.000 175 1.000 Domainoid score I3594
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37416
Inparanoid 1 1.050 179 1.000 Inparanoid score I4008
OMA 1 1.010 - - QHG62169
OrthoDB 1 1.010 - - D1434984at2759
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - otm25170
orthoMCL 1 0.900 - - OOG6_100904
Panther 1 1.100 - - O PTHR11710
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X617
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.