DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19b and rps1902

DIOPT Version :9

Sequence 1:NP_001262891.1 Gene:RpS19b / 42830 FlyBaseID:FBgn0039129 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_595221.1 Gene:rps1902 / 2541084 PomBaseID:SPBC649.02 Length:143 Species:Schizosaccharomyces pombe


Alignment Length:139 Identity:65/139 - (46%)
Similarity:88/139 - (63%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPGVTVKEIDQHVLTKNMAAFLKKSGKIFVPEQAVYMKTGKFKETAPTDDDWFYTRCASIMRHLY 65
            |.||:||::|........|||||:|||:..|:....:|||..||.||.|.||:|.|.|:|.||:|
pombe     1 MAGVSVKDVDAQQFINAYAAFLKRSGKMTTPQWIDIVKTGTHKELAPYDPDWYYVRAAAIARHIY 65

  Fly    66 LRSPAGVGAFTKVYSGRKRNGVRPSKHCRSSDGCIRKALQALEAANMVERHPDGGRKLTPQGQRN 130
            ||...|||...|||.|....|:|||.|...|....||.:|:||...::|:..:|||:::.||||:
pombe    66 LRKQVGVGRLCKVYGGSVNRGMRPSHHRDGSGSVQRKVVQSLEKIGVLEKSDNGGRRISQQGQRD 130

  Fly   131 LDRIANKIV 139
            |||||..::
pombe   131 LDRIAYSLL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19bNP_001262891.1 Ribosomal_S19e 5..138 CDD:279436 62/132 (47%)
rps1902NP_595221.1 Ribosomal_S19e 5..138 CDD:279436 62/132 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1166
eggNOG 1 0.900 - - E1_COG2238
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1319
OMA 1 1.010 - - QHG62169
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - mtm9295
orthoMCL 1 0.900 - - OOG6_100904
Panther 1 1.100 - - O PTHR11710
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X617
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.