DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19b and Rps19

DIOPT Version :9

Sequence 1:NP_001262891.1 Gene:RpS19b / 42830 FlyBaseID:FBgn0039129 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001347044.1 Gene:Rps19 / 20085 MGIID:1333780 Length:157 Species:Mus musculus


Alignment Length:144 Identity:85/144 - (59%)
Similarity:104/144 - (72%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPGVTVKEIDQHVLTKNMAAFLKKSGKIFVPEQAVYMKTGKFKETAPTDDDWFYTRCASIMRHLY 65
            |||||||:::|....:.:|||||||||:.|||....:|..|.||.||.|::|||||.||..||||
Mouse    13 MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAASTARHLY 77

  Fly    66 LRSPAGVGAFTKVYSGRKRNGVRPSKHCRSSDGCIRKALQALEAANMVERHPDGGRKLTPQGQRN 130
            ||..||||:.||:|.||:|||||||...|.|....|:.|||||...|||:..||||||||||||:
Mouse    78 LRGGAGVGSMTKIYGGRQRNGVRPSHFSRGSKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRD 142

  Fly   131 LDRIANKIVAKQRE 144
            |||||.::.|..::
Mouse   143 LDRIAGQVAAANKK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19bNP_001262891.1 Ribosomal_S19e 5..138 CDD:279436 80/132 (61%)
Rps19NP_001347044.1 Ribosomal_S19e 17..153 CDD:307302 80/135 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839273
Domainoid 1 1.000 178 1.000 Domainoid score I3543
eggNOG 1 0.900 - - E1_COG2238
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37416
Inparanoid 1 1.050 187 1.000 Inparanoid score I3904
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62169
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - otm43018
orthoMCL 1 0.900 - - OOG6_100904
Panther 1 1.100 - - O PTHR11710
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X617
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.