DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19b and rps-19

DIOPT Version :9

Sequence 1:NP_001262891.1 Gene:RpS19b / 42830 FlyBaseID:FBgn0039129 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001366893.1 Gene:rps-19 / 172805 WormBaseID:WBGene00004488 Length:146 Species:Caenorhabditis elegans


Alignment Length:135 Identity:76/135 - (56%)
Similarity:97/135 - (71%) Gaps:2/135 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TVKEIDQHVLTKNMAAFLKKSGKIFVPEQAVYMKTGKFKETAPTDDDWFYTRCASIMRHLYLRSP 69
            ::|::|||..||::|.|||||||:.|||.:..:|.|..||.||.|.||||||.||:.||||.| |
 Worm     6 SIKDVDQHEATKSIAHFLKKSGKVKVPEWSDLVKLGVNKELAPVDPDWFYTRAASLARHLYFR-P 69

  Fly    70 AGVGAFTKVYSGRKRNGVRPSKHCRSSDGCIRKALQALEAANMVERHPDG-GRKLTPQGQRNLDR 133
            ||:|||.|||.|.||.||.|:....|:..|:|||:|.||....||:|||| ||.|:.||:::|||
 Worm    70 AGIGAFKKVYGGNKRRGVAPNHFQTSAGNCLRKAVQQLEKIKWVEKHPDGKGRILSKQGRKDLDR 134

  Fly   134 IANKI 138
            ||..:
 Worm   135 IATSL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19bNP_001262891.1 Ribosomal_S19e 5..138 CDD:279436 76/133 (57%)
rps-19NP_001366893.1 Ribosomal_S19e 6..139 CDD:395866 76/133 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 161 1.000 Domainoid score I2443
eggNOG 1 0.900 - - E1_COG2238
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I2854
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62169
OrthoDB 1 1.010 - - D1434984at2759
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - otm14233
orthoMCL 1 0.900 - - OOG6_100904
Panther 1 1.100 - - O PTHR11710
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X617
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.