DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19b and AgaP_AGAP010933

DIOPT Version :9

Sequence 1:NP_001262891.1 Gene:RpS19b / 42830 FlyBaseID:FBgn0039129 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_563989.1 Gene:AgaP_AGAP010933 / 1271018 VectorBaseID:AGAP010933 Length:158 Species:Anopheles gambiae


Alignment Length:144 Identity:87/144 - (60%)
Similarity:111/144 - (77%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPGVTVKEIDQHVLTKNMAAFLKKSGKIFVPEQAVYMKTGKFKETAPTDDDWFYTRCASIMRHLY 65
            |||:|||::||..:.:.:|.|||||||:.||:....:||.||||.||||.||||.|||||:|.||
Mosquito     1 MPGITVKDVDQDKVVEGVALFLKKSGKLKVPDYVDLIKTAKFKELAPTDPDWFYVRCASILRRLY 65

  Fly    66 LRSPAGVGAFTKVYSGRKRNGVRPSKHCRSSDGCIRKALQALEAANMVERHPDGGRKLTPQGQRN 130
            ..||||:|:..::|.||:|:|||||..||:.....|||:|||||..|:|||.||||||:.||||:
Mosquito    66 HHSPAGIGSICRIYGGRQRHGVRPSHFCRADGSATRKAVQALEAIKMIERHADGGRKLSSQGQRD 130

  Fly   131 LDRIANKIVAKQRE 144
            |||||.:|.:|:||
Mosquito   131 LDRIAAQISSKKRE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19bNP_001262891.1 Ribosomal_S19e 5..138 CDD:279436 80/132 (61%)
AgaP_AGAP010933XP_563989.1 Ribosomal_S19e 5..138 CDD:279436 80/132 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2238
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62169
OrthoDB 1 1.010 - - D1434984at2759
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11710
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X617
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.