DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19b and LOC120095010

DIOPT Version :9

Sequence 1:NP_001262891.1 Gene:RpS19b / 42830 FlyBaseID:FBgn0039129 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_038942948.1 Gene:LOC120095010 / 120095010 RGDID:41050173 Length:145 Species:Rattus norvegicus


Alignment Length:144 Identity:80/144 - (55%)
Similarity:99/144 - (68%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPGVTVKEIDQHVLTKNMAAFLKKSGKIFVPEQAVYMKTGKFKETAPTDDDWFYTRCASIMRHLY 65
            |||||||:::|....:.:|||||||||:.|||....:|..|.||.||.|::||||..||..||||
  Rat     1 MPGVTVKDVNQREFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTGAASTARHLY 65

  Fly    66 LRSPAGVGAFTKVYSGRKRNGVRPSKHCRSSDGCIRKALQALEAANMVERHPDGGRKLTPQGQRN 130
            ||..||||:.||:|.|::||.||||...|.|....|...||||...|||:..||||||||||||:
  Rat    66 LRGGAGVGSMTKIYGGQQRNCVRPSHFSRGSKSMARWVFQALEGLKMVEKDQDGGRKLTPQGQRD 130

  Fly   131 LDRIANKIVAKQRE 144
            .||||.::.|..::
  Rat   131 RDRIAGQVAAANKK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19bNP_001262891.1 Ribosomal_S19e 5..138 CDD:279436 75/132 (57%)
LOC120095010XP_038942948.1 Ribosomal_S19e 5..141 CDD:395866 75/135 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 178 1.000 Domainoid score I3457
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I3820
OMA 1 1.010 - - QHG62169
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - mtm9051
orthoMCL 1 0.900 - - OOG6_100904
Panther 1 1.100 - - O PTHR11710
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X617
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.