DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19b and rps19

DIOPT Version :9

Sequence 1:NP_001262891.1 Gene:RpS19b / 42830 FlyBaseID:FBgn0039129 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_002939172.2 Gene:rps19 / 100379722 XenbaseID:XB-GENE-968799 Length:145 Species:Xenopus tropicalis


Alignment Length:144 Identity:83/144 - (57%)
Similarity:105/144 - (72%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPGVTVKEIDQHVLTKNMAAFLKKSGKIFVPEQAVYMKTGKFKETAPTDDDWFYTRCASIMRHLY 65
            |||||||:::|....:.:|||||||||:.|||....:|..|.||.||.|::|||||.||.:||||
 Frog     1 MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPCDENWFYTRAASTVRHLY 65

  Fly    66 LRSPAGVGAFTKVYSGRKRNGVRPSKHCRSSDGCIRKALQALEAANMVERHPDGGRKLTPQGQRN 130
            ||..||||:.||:|.||:||||.||...:.|....|:.|||||...|||:.|:|||||||||||:
 Frog    66 LRGGAGVGSMTKIYGGRQRNGVMPSHFSKGSKSVARRVLQALENLKMVEKDPNGGRKLTPQGQRD 130

  Fly   131 LDRIANKIVAKQRE 144
            |||||.::.|..::
 Frog   131 LDRIAGQVAAASKK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19bNP_001262891.1 Ribosomal_S19e 5..138 CDD:279436 78/132 (59%)
rps19XP_002939172.2 Ribosomal_S19e 5..141 CDD:376455 78/135 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 176 1.000 Domainoid score I3558
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37416
Inparanoid 1 1.050 185 1.000 Inparanoid score I3815
OMA 1 1.010 - - QHG62169
OrthoDB 1 1.010 - - D1434984at2759
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - otm48140
Panther 1 1.100 - - O PTHR11710
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X617
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.