DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19b and LOC100360843

DIOPT Version :9

Sequence 1:NP_001262891.1 Gene:RpS19b / 42830 FlyBaseID:FBgn0039129 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_002728718.5 Gene:LOC100360843 / 100360843 RGDID:2321315 Length:145 Species:Rattus norvegicus


Alignment Length:144 Identity:83/144 - (57%)
Similarity:102/144 - (70%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPGVTVKEIDQHVLTKNMAAFLKKSGKIFVPEQAVYMKTGKFKETAPTDDDWFYTRCASIMRHLY 65
            ||.||||:::|....:.:|||||||||:.|||....:|..|.||.||.|::|.|||.||..||||
  Rat     1 MPRVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWLYTRAASTARHLY 65

  Fly    66 LRSPAGVGAFTKVYSGRKRNGVRPSKHCRSSDGCIRKALQALEAANMVERHPDGGRKLTPQGQRN 130
            ||..||||:.||:|.||:|||||||...|.|....|:.|||||...|||:..||||||||||||:
  Rat    66 LRGGAGVGSMTKIYGGRQRNGVRPSHFSRGSKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRD 130

  Fly   131 LDRIANKIVAKQRE 144
            |||||.::.|..::
  Rat   131 LDRIAGQVAAANKK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19bNP_001262891.1 Ribosomal_S19e 5..138 CDD:279436 79/132 (60%)
LOC100360843XP_002728718.5 Ribosomal_S19e 5..141 CDD:395866 79/135 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343084
Domainoid 1 1.000 178 1.000 Domainoid score I3457
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I3820
OMA 1 1.010 - - QHG62169
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - mtm9051
orthoMCL 1 0.900 - - OOG6_100904
Panther 1 1.100 - - O PTHR11710
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X617
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.