DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and MPA43

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_014150.1 Gene:MPA43 / 855472 SGDID:S000005193 Length:542 Species:Saccharomyces cerevisiae


Alignment Length:277 Identity:53/277 - (19%)
Similarity:101/277 - (36%) Gaps:79/277 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 VLSDDTDPMVTVMKLEKAPQETYADI---GGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVI 222
            :|.|..|       :.:..::|..||   .||...|          ||             |.:.
Yeast   325 ILKDGAD-------IYQVLEQTIRDIEKNNGLSIHI----------LT-------------KDMF 359

  Fly   223 LYG------PPGTGKTLLAKAVANQTSATFLRVVGSEL-IQKYLGDGPKLVRELFRVAEEHAPSI 280
            .||      .|.....:....:...|..:.|.:....: |.::|....||:.:.|    ::..|.
Yeast   360 FYGDYEGNRTPFADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTF----QNENSN 420

  Fly   281 VFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGR 345
            :.|.|:...|     |.:..||.:  :::.|:|        ..|.:|...   |.:|...|:...
Yeast   421 IHIKELRISG-----SQAKNERLL--SLISLVN--------NGVAIIKPK---ENVDMMGIKGAY 467

  Fly   346 IDRKIEFPLPDEKTKRRIFTIHTSRMTLAED----VNLSELIMAKDDLSGADIKAICTEAGL--- 403
            :..|      ..|.|:::..:.|.| .::.|    .:|:|..:..|.:...  |.:|.:..:   
Yeast   468 VLAK------SAKEKKQLADVITER-DISNDSEKFESLAEYRLGNDSILLR--KLLCVKYHIHLD 523

  Fly   404 MALRERRM-KVTNEDFK 419
            ||.:::|. |:.:|.|:
Yeast   524 MAKQQKRYHKLVDEVFQ 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 53/277 (19%)
MPA43NP_014150.1 AraB 4..542 CDD:223995 53/277 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.