DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and RPT6

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_011467.1 Gene:RPT6 / 852834 SGDID:S000003016 Length:405 Species:Saccharomyces cerevisiae


Alignment Length:377 Identity:180/377 - (47%)
Similarity:252/377 - (66%) Gaps:12/377 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IKDYL---MMEDEF-IR----NQERLKPQ-DEKNEEERSKVDDLR--GTPMS-VGNLEEIIDDNH 119
            ||.|.   :.|.|. ||    |..||:.| :..|::.|...|:||  ..|.| ||.:.:|:.|..
Yeast    19 IKPYFEQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKDELRLLQEPGSYVGEVIKIVSDKK 83

  Fly   120 AIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYA 184
            .:|......::.|.:...::...|:....|.|....:.:..||.:..||:|::|.:||.|..||.
Yeast    84 VLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKVPDSTYD 148

  Fly   185 DIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRV 249
            .:|||..||:||||.:|||:.|||.:|.:||..||||||||||||||||||:|||:.|...|:||
Yeast   149 MVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRV 213

  Fly   250 VGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQ 314
            .|:||:|||:|:|.::|||||.:|.||||||:|:||||::|:.|.:.:.||:.|:||||||||||
Yeast   214 SGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQ 278

  Fly   315 LDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNL 379
            ||||::..::|:||||||::.|||||:||||||||||||.|....:..|..||:.:|.|...:||
Yeast   279 LDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINL 343

  Fly   380 SELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKE 431
            .::....:..||||:|.:|||||:.||||||:.||.|||:.:...|:.:.:|
Yeast   344 RKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 180/377 (48%)
RPT6NP_011467.1 RPT1 12..403 CDD:224143 180/377 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.